(data stored in ACNUC1104 zone)

EMBL: CP000509.PE167

CP000509.PE167       Location/Qualifiers
FT   CDS_pept        185229..185696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0172"
FT                   /product="Mycobacterium tuberculosis paralogous family 11"
FT                   /note="PFAM: Mycobacterium tuberculosis paralogous family
FT                   11; KEGG: rha:RHA1_ro02638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79717"
FT                   /db_xref="GOA:A1SD32"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD32"
FT                   /protein_id="ABL79717.1"
FT                   /translation="MNPLRWLALRLGAQPWLPRFARVIVTLDLTTQRLSRGRVDLLTFA
FT                   GLPELLLQVPGRRTGVLRSTPLLCVPHGDGWLVAGSNWGAPTPPAWVANVLGADEPLVT
FT                   FRGHTVAADALLLTGPDRDEAWAVMTGTWPNYAKYAERTGRELPVILLTPR"
     atgaacccgc tgcgctggct ggccctgcgg ctgggtgccc aaccgtggct gccccggttc        60
     gcccgggtga tcgtcaccct cgacctgacg acccagcggc tcagccgcgg ccgggtggac       120
     ctcctgacct tcgcgggtct gcccgagctg ctgctccagg tcccgggccg gcgcaccggc       180
     gtactgcgct cgacgccgct gctgtgcgtc ccgcacggcg acggctggct ggtggcgggc       240
     tccaactggg gcgcgcccac ccctcccgcc tgggtcgcca acgtgctggg cgccgacgag       300
     ccgctggtca ccttccgggg ccacaccgtc gccgccgacg ccctcctgct gaccggcccg       360
     gaccgtgacg aggcctgggc ggtgatgacc ggcacctggc cgaactacgc gaagtacgcc       420
     gagcgcaccg gccgggagct ccccgtcatc ctcctcaccc cccgctag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page