(data stored in ACNUC1104 zone)

EMBL: CP000509.PE168

CP000509.PE168       Location/Qualifiers
FT   CDS_pept        complement(185796..187316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0173"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related;
FT                   diacylglycerol kinase, catalytic region; KEGG: lxx:Lxx21980
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79718"
FT                   /db_xref="GOA:A1SD33"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD33"
FT                   /protein_id="ABL79718.1"
FT                   /translation="MFVLVTIAVQTGWGPVTSIDNRGQGAETWAVDERWLRLPLRWIEV
FT                   GFGAIGTWVIVGVLAVLLFVRQHRRAAVYAVGVVAVTKIATTILKAVFGRHRPDWQNPE
FT                   HLLDSNAYPSGHSSTIVALVGVAAVLVMMLVRRRSARHTAYALLAVLAVVVGLDRVLLG
FT                   RHFPSDVVGGALLGAIVVLLGIVVQNPLPRSHAASVEPLPEVFGSEHRLTVILNPVKVE
FT                   DVGQFEALVTAMAAEAGWSAPTWHYTTVEDPGTGMAEAAAVAGTDLVLVCGGDGTVREV
FT                   CAELAGTGIPVGIIPAGTGNLLARNLDIPLYLRAAIDVALTGQDRAIDLVEVSGDGFED
FT                   THFMVMAGMGFDAAIMEGVNEDIKKRVGWLAYVLSALKSLMFPAVRVEVSVDGGEFTRH
FT                   RARTIVVGNVGFLQAGMPLLPDAAIDDGVLDVVMLHPRRFLSWIPLAYRVLARRPRTDE
FT                   LVNRMTGHTVVVRASTDTPRQLDGDSIGPGRELRMTCVHGRLLVRVPR"
     atgttcgtcc tggtcaccat cgccgtgcag accggctggg gaccggtgac ctcgatcgac        60
     aaccggggcc agggcgccga gacctgggcc gtcgacgagc gctggctgcg cctgccgctg       120
     cgctggatcg aggtcggctt cggcgccatc ggcacctggg tgatcgtcgg cgtgctcgcc       180
     gtgctgctgt tcgtgcggca gcaccgacgc gccgcggtgt acgccgtcgg cgtggtggcg       240
     gtcaccaaga tcgccaccac gatcctcaag gccgtgttcg ggcggcaccg tcccgactgg       300
     cagaaccccg agcacctgct ggacagcaac gcctacccca gcggtcactc ctcgacgatc       360
     gtcgcgctcg tcggggtcgc cgcggtgctg gtgatgatgc tggtccggcg gcgcagcgcc       420
     cggcacacgg cgtacgccct cctcgccgtg ctggcggtcg tggtgggcct cgaccgggtg       480
     ctgctcggtc ggcacttccc gagcgacgtg gtcggcgggg ccctcctcgg cgcgatcgtc       540
     gtcctgctcg ggatcgtcgt ccagaacccg ctcccccgta gccatgccgc cagcgtcgag       600
     ccgctgcccg aggtcttcgg gtccgagcac cggctgacgg tgatcctcaa cccggtcaag       660
     gtggaggacg tcggccagtt cgaggcgctg gtcaccgcga tggccgccga ggccggctgg       720
     tccgcaccga cctggcacta cacgaccgtc gaggaccccg gcaccgggat ggccgaggcc       780
     gccgcggtcg ccggcaccga cctggtactc gtgtgcggcg gcgacggcac cgtgcgcgag       840
     gtctgcgcgg agctggccgg caccgggatc ccggtcggga tcatcccggc gggcaccggc       900
     aacctgctgg cccgcaacct cgacatcccg ctctacctgc gggcggcgat cgacgtcgcc       960
     ctcaccggtc aggaccgcgc gatcgacctg gtggaggtct ccggcgacgg cttcgaggac      1020
     acccacttca tggtgatggc cgggatgggc ttcgacgccg cgatcatgga gggcgtcaac      1080
     gaggacatca agaagcgggt cggctggctg gcctacgtgc tctccgcgct caagtcgctg      1140
     atgttccccg ccgtccgggt cgaggtctcg gtcgacggcg gcgagttcac caggcaccgg      1200
     gcccgcacga tcgtggtcgg gaacgtcggc ttcctccagg ccgggatgcc gctgctgccg      1260
     gacgccgcga tcgacgacgg cgtcctcgac gtggtgatgc tgcacccgcg gcggttcctg      1320
     tcgtggatcc cgctggccta ccgggtgctg gcccggcgcc cgcgcaccga cgagctcgtg      1380
     aaccggatga ccgggcacac cgtcgtcgtc cgcgcctcca ccgacacccc ccgccagctc      1440
     gacggcgact cgatcggccc cggccgcgag ctccggatga cctgtgtcca cggccggctg      1500
     ctggtccgag tgccccgcta g                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page