(data stored in ACNUC1104 zone)

EMBL: CP000509.PE170

CP000509.PE170       Location/Qualifiers
FT   CDS_pept        188777..189625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0175"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   sucrose-6F-phosphate phosphohydrolase; Haloacid
FT                   dehalogenase domain protein hydrolase, type 3; KEGG:
FT                   pac:PPA2205 hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79720"
FT                   /db_xref="GOA:A1SD35"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD35"
FT                   /protein_id="ABL79720.1"
FT                   /translation="MSGPVSGWRPRLVALDIDGTILKWVEGSGTTREEISPTVKESVHR
FT                   VLAAGAHVVLASGRSPHGMTNVADLLELHGPGRDRLWIVASNGAVVFRYPPLDVVHEET
FT                   FDARPAVEAILDRHPTALVAVEERGVGYRVNSHFPDGELSGDMIVTEIDELLAVEVSRV
FT                   IIRDPESTADEFVALAEELGLQGTNYVVGWTAWLDLAPVGVSKASGLEYVAKQLGISSD
FT                   DTLALGDGRNDVEMFEWAHRGVAMGQAIEEVLAKADAVTGSVYEDGVATELDRWFGDGR
FT                   A"
     gtgagcggac ccgtgagcgg ctggcggccc cggctcgtcg ccctcgacat cgacggcacg        60
     atcctgaagt gggtggaggg gtcgggcacc acccgcgagg agatctcacc cacggtcaag       120
     gagtcggtgc accgcgtcct ggccgccggt gcccacgtgg tgctggccag cggccggtcc       180
     ccgcacggca tgaccaacgt ggcggacctg ctcgagctgc acggtccggg ccgcgaccgg       240
     ctctggatcg tggcgtccaa cggtgccgtg gtgttccgct acccgccgct cgacgtggtc       300
     cacgaggaga ccttcgacgc gcggccggcc gtggaggcga tcctcgaccg gcacccgacc       360
     gcgctcgtgg cggtcgagga gcgcggcgtc ggctaccggg tcaactcgca cttcccggac       420
     ggcgagctgt ccggcgacat gatcgtcacc gagatcgacg agctgctcgc ggtcgaggtc       480
     agccgggtga tcatccgcga cccggagtcc accgccgacg agttcgtcgc gctcgccgag       540
     gagctggggc tgcagggcac caactacgtc gtcggctgga ccgcctggct cgacctcgcc       600
     cccgtcggcg tctcgaaggc ctccgggctc gagtacgtcg ccaagcagct cggcatctcc       660
     tccgacgaca cccttgcgct cggcgacggc cgcaacgacg tcgagatgtt cgagtgggcg       720
     caccgcgggg tcgcgatggg ccaggcgatc gaggaggtcc tggcgaaggc cgacgccgtc       780
     accggcagcg tctacgagga cggcgtggcg accgagctgg accggtggtt cggggacggg       840
     cgcgcctga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page