(data stored in SCRATCH zone)

EMBL: CP000509.PE171

CP000509.PE171       Location/Qualifiers
FT   CDS_pept        189625..190122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0176"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sco:SCO4311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79721"
FT                   /db_xref="GOA:A1SD36"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD36"
FT                   /protein_id="ABL79721.1"
FT                   /translation="MLPDGPPEVVTSERLRLPLWTPQDAADIRAGRHREGWHRDYPRPD
FT                   DRDAATIYRSGDPWAPRHVVRGVTALGSIGFFGPPQAAADGVPEVEVGYGLVAEARGWG
FT                   FATEALRALLAETDRAGVRVRASVDPANTASVRVLAKCGFTELRGSNEDGELVMARPLP
FT                   AS"
     atgctgcccg acggtcctcc tgaggtggtc accagcgagc ggctccggct gccgctgtgg        60
     acgccgcagg acgccgccga catccgggcc ggccggcacc gggagggttg gcaccgcgac       120
     tacccgcggc ccgacgaccg cgatgcggcc acgatctacc ggtccggcga cccgtgggcg       180
     ccccggcacg tcgtgcgcgg ggtgaccgcc ctgggctcga tcggcttctt cgggccgccc       240
     caggccgccg ccgacggggt gcccgaggtc gaggtcggct acggcctcgt ggcggaggcc       300
     cgcggttggg ggttcgcgac cgaggcgctg cgggcgctcc tcgccgagac cgaccgggcc       360
     ggcgtccggg tgcgcgcgag cgtggatccg gcgaacacgg ccagcgtccg ggtgctcgcg       420
     aagtgcgggt tcaccgagct gcgcggcagc aacgaggacg gcgagctggt catggcccgg       480
     ccgctgccgg cgtcgtga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page