(data stored in SCRATCH zone)

EMBL: CP000509.PE172

CP000509.PE172       Location/Qualifiers
FT   CDS_pept        190119..190913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0177"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   Haloacid dehalogenase domain protein hydrolase, type 3;
FT                   KEGG: sco:SCO3950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79722"
FT                   /db_xref="GOA:A1SD37"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD37"
FT                   /protein_id="ABL79722.1"
FT                   /translation="MTRPRLVATDLDGTLVRSDGTVSPYTREVLTAVEAAGAIVVFVTG
FT                   RPLRWAEEVFDHVGEHGLAVVANGALVWDVGRHDVHLLRPIDPALGLEASELLRAALPG
FT                   TTFAVETVDGIGLEPEFLERHPLPEDARRGPLTELFDRPAVKLLARHEELGPQEFWDLA
FT                   EEALGGRLVITWSSASALLEISAPGVTKASTLALLCADLGVEAEEVIAFGDMPNDLPML
FT                   AWAGSSYAMADAHPTVTAAADHVAPGHDEDGVARVLAGVFDL"
     gtgacccgcc cgcgcctggt cgccaccgac ctcgacggca ccctggtccg ctccgacggc        60
     acggtctcgc cgtacacccg cgaggtgctc acggccgtcg aggccgccgg cgcgatcgtg       120
     gtcttcgtga ccggccgccc cctgcgctgg gccgaggagg tcttcgacca cgtcggcgag       180
     cacggcctcg cggtcgtcgc gaacggcgcg ctcgtctggg acgtcggccg ccacgacgtg       240
     cacctgctcc gcccgatcga cccggcgctc gggctcgagg cgtccgagct gctgcgcgcc       300
     gcgctgcccg gtacgacgtt cgccgtcgag accgtcgacg ggatcggcct cgagccggag       360
     ttcctcgagc ggcacccgct gcccgaggac gcccggcggg gcccgctcac cgagctgttc       420
     gaccgcccgg cggtcaagct gctcgcccgg cacgaggagc tcgggccgca ggagttctgg       480
     gacctcgccg aggaggcgct cggcggccgg ctggtgatca cctggtcctc cgcgagcgcg       540
     ctgctcgaga tcagcgcgcc gggggtgacc aaggcctcca ccctcgcgct gctgtgcgcc       600
     gatctcgggg tcgaggcgga ggaggtgatc gccttcggcg acatgccgaa cgacctgccg       660
     atgctcgcgt gggccggcag ctcctacgcg atggccgacg cccacccgac ggtcactgcg       720
     gcggccgacc acgtcgcgcc gggacacgac gaggacggcg tggcccgggt cctggctggt       780
     gtgttcgacc tgtga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page