(data stored in ACNUC1104 zone)

EMBL: CP000509.PE173

CP000509.PE173       Location/Qualifiers
FT   CDS_pept        190923..191534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79723"
FT                   /db_xref="GOA:A1SD38"
FT                   /db_xref="InterPro:IPR008993"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD38"
FT                   /protein_id="ABL79723.1"
FT                   /translation="MDAVPVPVPGSVTRLPRLLLAALLLAGGGVVATGAMAAPALACPA
FT                   SRTGLDQLTMQADDVFTGAVEDRARQGRTIVYTVTVDRVYKGDLDGTEATVTTPARARA
FT                   CGLPDLRTGTDYVFFTQGADLETTSTAGTAPAAATLLRRVERLLGEGHPATPPTPPEAT
FT                   FTLVGEQPTSFERVAAPGAALVIAGLLGLLLVAGLSRRRA"
     atggacgccg tgcccgtgcc cgttcctggg tctgtgaccc gcctgccccg gctcctgctg        60
     gccgccctgc tgctcgccgg cggcggtgtc gtcgcgaccg gcgccatggc ggcccccgcc       120
     ctcgcctgcc cggcgtctcg gaccggtctg gatcagctga cgatgcaggc cgacgacgtc       180
     ttcaccggcg ccgtcgagga ccgggcccgg cagggccgca cgatcgtcta cacggtcacc       240
     gtcgaccggg tctacaaggg cgacctcgac ggcaccgagg ccaccgtcac gaccccggcc       300
     cgggcgcggg cctgtgggct gccggacctg cgcaccggca ccgactacgt cttcttcacc       360
     cagggtgccg acctcgagac cacgagcacc gccgggaccg cgcccgcggc cgccaccctg       420
     ctgcgtcgcg tggagcggct gctcggcgag ggtcaccccg cgacgccgcc gacgccgccc       480
     gaggcgacct tcacgctggt cggcgagcag cccaccagct tcgagcgggt cgccgcgccc       540
     ggcgcggccc tcgtcatcgc cggcctgctg ggcctgctgc tcgtcgccgg cctgagccgc       600
     cgccgggcct ag                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page