(data stored in ACNUC1104 zone)

EMBL: CP000509.PE174

CP000509.PE174       Location/Qualifiers
FT   CDS_pept        complement(191631..192209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79724"
FT                   /db_xref="GOA:A1SD39"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD39"
FT                   /protein_id="ABL79724.1"
FT                   /translation="MNEQPGQDEQEQQVVIIGPDGHPMGSVPASALEPGESGDEDDERA
FT                   ITDLVEQPAKVMRIGSMIRQLLEEVKAAPLDEASRNRLKEIHQASIKELEAGLAPELVE
FT                   ELDRLTLPFTEDTVPSDGELRIAQAQLVGWLEGLFHGIQTAIYAQQMAARAQFEQIRKA
FT                   LPQAMNPGAGQPRPDGEAPRPGDSGGMYL"
     atgaacgagc agcccggaca ggacgagcag gagcagcagg tcgtgatcat cggccccgac        60
     ggccacccga tgggatcggt cccggcgtcc gcgctcgagc ccggcgagag cggggacgag       120
     gacgacgagc gggcgatcac cgacctggtc gagcagccgg cgaaggtgat gcggatcggc       180
     agcatgatcc gccagctgct cgaggaggtg aaggccgcgc ccctcgacga ggcgagccgc       240
     aaccggctca aggagatcca ccaggcctcg atcaaggagc tcgaggccgg gctcgcgccg       300
     gagctggtgg aggagctgga ccggctgacg ctgccgttca ccgaggacac cgtcccctcc       360
     gacggggagc tgcggatcgc acaggcccag ctggtcggct ggctcgaggg cctcttccac       420
     ggcatccaga ccgcgatcta cgcccagcag atggccgccc gcgcccagtt cgagcagatc       480
     cggaaggcgc tgccgcaggc catgaacccc ggcgccggtc agccccggcc cgacggcgag       540
     gcgccgcgcc cgggcgactc cgggggcatg tacctgtag                              579
//

If you have problems or comments...

PBIL Back to PBIL home page