(data stored in SCRATCH zone)

EMBL: CP000509.PE175

CP000509.PE175       Location/Qualifiers
FT   CDS_pept        complement(192241..193218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0180"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sma:SAV4368 quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79725"
FT                   /db_xref="GOA:A1SD40"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD40"
FT                   /protein_id="ABL79725.1"
FT                   /translation="MRAVIATGAGGPDVLSVAELPDPEPGPGEVLLAVAAAGLNRADLL
FT                   QRQGFYPPPPGASDVIGMECSGTVAALGEGVEGWAVGDPACALLAGGGYAELVAVPSGQ
FT                   LMPVPDGVDLVTAAALPEVACTVWSNVFMLGGLKPGEAFLVHGGAGGIGTFAIQLAHQL
FT                   GAQVLTTAGTAEKRAACAALGADVTIDYRDQDFVEVARAATEGRGVDLVLDNMGAKYLD
FT                   RNLDALATEGRLVIIGMQGGTRAELDINKLLRKRGAIIATTLRARPTEEKSAICASVVE
FT                   HVWPLVAEGLVRPVVHGTMPLAEAGAAHALMESGEHSGKILLTV"
     atgcgtgccg tgatcgccac cggggccggg ggccccgacg tcttgtccgt cgccgagctc        60
     cccgaccccg agcccggtcc cggcgaggtc ctgctcgcgg tcgcggccgc gggcctcaac       120
     cgggccgacc tgctgcagcg gcagggcttc tacccgccac cgcccggcgc gtccgacgtg       180
     atcggcatgg agtgcagtgg cacggtcgcc gcgctcggcg agggcgtcga ggggtgggcg       240
     gtcggcgacc cggcgtgcgc cctgctcgcc gggggcgggt acgccgagct ggtcgccgta       300
     ccgtccgggc agctgatgcc ggtgcccgac ggcgtcgacc tggtgaccgc cgccgcgctg       360
     cccgaggtgg cctgcacggt gtggtcgaac gtgttcatgc tcggcggcct caagcccggc       420
     gaggcgttct tggtgcacgg cggcgccggc ggcatcggga cgttcgcgat ccagctcgcg       480
     caccagctcg gcgcgcaggt cctcacgacg gccggcaccg ccgagaagcg cgccgcgtgc       540
     gcggccctcg gtgccgacgt cacgatcgac taccgcgacc aggacttcgt cgaagtggct       600
     cgggccgcga ccgaggggcg gggcgtggac ctggtcctcg acaacatggg cgcgaagtac       660
     ctcgaccgca acctggacgc cctggccacc gagggccggc tggtgatcat cgggatgcag       720
     ggcggcaccc gggccgagct cgacatcaac aagctgctgc gcaagcgcgg ggcgatcatc       780
     gccaccaccc tgcgggcccg ccccaccgag gagaagtcgg cgatctgcgc ctccgtcgtc       840
     gagcacgtgt ggccgctggt ggccgagggt ctcgtccggc cggtcgtgca cggcaccatg       900
     ccgttggccg aggccggcgc cgcccacgcg ctgatggagt ccggcgagca cagcgggaag       960
     atcctgctca ccgtctga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page