(data stored in ACNUC1104 zone)

EMBL: CP000509.PE176

CP000509.PE176       Location/Qualifiers
FT   CDS_pept        complement(193256..193606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO3828 molybdopterin-guanine dinucleotide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79726"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD41"
FT                   /protein_id="ABL79726.1"
FT                   /translation="MNLHDWIDELSDVLDVDTELDEALVLDLARAAAHNVARPAAPITT
FT                   FLLGFAAGSQDADPDAVEALAAKAQALADGWDRPANAPDPDDINDPVPDDSVVDHTGDV
FT                   FEDENAGADEEE"
     gtgaacctcc acgactggat cgacgagctg agcgacgtgc tcgatgtgga caccgagctg        60
     gacgaggcgc tcgtgctcga cctggcccgc gccgccgccc acaacgtcgc gcggccggca       120
     gcgccgatca cgacgttcct cctcgggttc gccgccgggt cgcaggacgc cgaccccgac       180
     gccgtggagg ccctcgcggc gaaggcgcag gccctcgccg acggatggga ccgtccggcg       240
     aacgctcccg accccgacga catcaacgac ccggtccccg acgacagcgt cgtggaccac       300
     accggcgacg tcttcgagga cgagaacgcc ggggccgacg aggaggagtg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page