(data stored in ACNUC1104 zone)

EMBL: CP000509.PE177

CP000509.PE177       Location/Qualifiers
FT   CDS_pept        complement(193659..194276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0182"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein"
FT                   /note="KEGG: sma:SAV4365 molybdopterin-guanine dinucleotide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79727"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD42"
FT                   /protein_id="ABL79727.1"
FT                   /translation="MDLPPGTTGFCAVVLAGGRAARLDGADKASVEYLGRTLLEHAIEA
FT                   LLDASEVVVVGDPVPTTRPVTFTRESPRYGGPVAGLLTGRDALVRTPRTLGVLAVDMPR
FT                   VTSWTFRRLHEAAIGHDGAFLTDQDGHRQPAGVLDPAGLDRVRPDHEGQHGMALRRLLG
FT                   ELDLVDVPPEGDEGRDVDTWTDLRDLGRDPDRDPGRDLGGDL"
     atggacctcc ccccgggcac cacgggcttc tgcgcggtcg tcctcgccgg gggccgcgcc        60
     gcgcgcctgg acggcgcgga caaggcgtcg gtcgagtacc tcggccggac cctgctcgag       120
     cacgcgatcg aggcgctcct ggacgcctcg gaggtggtgg tcgtcggcga cccggtgccg       180
     accacccggc cggtcacctt cacccgggag agcccgcggt acggcggccc ggtcgcggga       240
     ctgctcaccg gccgcgacgc cctggtccgc acgccgcgca cgctcggcgt gctcgccgtg       300
     gacatgcccc gcgtgacctc gtggacgttc cgccgactgc acgaggcggc gatcgggcac       360
     gacggggcgt tcctcaccga ccaggacggg caccggcagc ccgccggggt cctggacccg       420
     gccggtctcg accgggtccg ccccgaccac gagggccagc acggcatggc cctgcgccgg       480
     ctgctgggcg agctggacct cgtcgacgtg ccgcccgagg gcgacgaggg acgcgacgtc       540
     gacacctgga ccgacctgcg tgacctgggc cgtgacccgg accgtgaccc gggccgtgac       600
     ctggggggcg acctgtga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page