(data stored in ACNUC1104 zone)

EMBL: CP000509.PE179

CP000509.PE179       Location/Qualifiers
FT   CDS_pept        195109..196179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79729"
FT                   /db_xref="GOA:A1SD44"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD44"
FT                   /protein_id="ABL79729.1"
FT                   /translation="MSRSTPRRRAERPPSRRARAAAALRTRAERVASSWVPVVLWVLVV
FT                   LAGLGALVSCLAEVGPGWLCGYGSVAVVTAYSWALAARTGGRPVVVGLLALVLGVVVVV
FT                   SDDDSLRTGAAVLTCAVSSVLAVMATVPAVRFVHVVREVVLAVLVAAIGALATVGFEPV
FT                   VTVERFEYAALALSFFGALVLVYRLGAGLHGLGRRGVVTVLMGSLLLAVTLAYAELLRR
FT                   YGTPGLVDSLLDVVDWSREHLGAFPRPLEVLLGVPALAWGTHMRARRRQGWWVCAFGVA
FT                   ATLPVAVALVNPRITLLESGLSAAYGVVVGLLIGFVVIRLDLAITGPRGGRGRRGRRAE
FT                   EASALRPEPSRTRALL"
     gtgtccaggt ccaccccgcg tcgtcgagcc gagcggccgc catcgcgccg ggcgcgcgcc        60
     gcggccgcgc tgcgcacccg tgccgagcgg gtcgccagct cgtgggtgcc ggtcgtcctg       120
     tgggtgctgg tggtgcttgc gggactgggg gcactcgtct cctgcctggc cgaggtcggc       180
     cccggatggc tctgcggcta cgggtcggtc gccgtggtga cggcgtactc ctgggcgctc       240
     gcggcgcgca ccggcggccg tccggtcgtg gtcgggctgc tggccctggt gctcggggtg       300
     gtcgtggtgg tcagtgacga cgactcgctg cgcaccggtg ccgccgtgct gacctgcgcg       360
     gtgtcgtcgg tgctggccgt gatggcgacg gtgccggcgg tccggttcgt gcacgtggtg       420
     cgcgaggtgg tgctcgccgt gctcgtggcc gcgatcggtg cgctggcgac cgtcgggttc       480
     gagccggtcg tcaccgtcga gcgcttcgag tacgccgctc tcgcgctgtc cttcttcggg       540
     gccctcgtgc tggtctaccg cctcggcgcc ggcctgcacg ggctgggccg ccgcggcgtg       600
     gtgacggtgc tgatgggcag cctcctgctc gcggtgacgc tggcgtacgc cgagctgctg       660
     cgccgctacg gcaccccggg cctggtcgac agcctgctcg acgtcgtcga ctggagccga       720
     gagcacctcg gtgccttccc gcgtcccctc gaggtgctgc tgggcgtccc cgcgctcgcc       780
     tggggcaccc acatgcgggc gcggcggcgg cagggctggt gggtctgcgc gttcggcgtg       840
     gcggccacgc tcccggtggc ggtggcgctg gtcaacccgc ggatcaccct cctggagagc       900
     gggctgtcgg cggcgtacgg cgtggtcgtc ggcctgctga tcggcttcgt cgtgatccgc       960
     ctcgacctgg ccatcaccgg accgcgcggc ggtcggggac gtcgcggccg gcgggccgag      1020
     gaggcgagcg ccctgcgccc cgagccgagc cggacccggg cgctgctgtg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page