(data stored in ACNUC1104 zone)

EMBL: CP000509.PE180

CP000509.PE180       Location/Qualifiers
FT   CDS_pept        196213..196446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0185"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: fra:Francci3_3765 biotin/lipoyl attachment"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79730"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD45"
FT                   /protein_id="ABL79730.1"
FT                   /translation="MAREQVTEVVAEMVANVLSVAVAPGDPVEAGDTVVLLESMKMEIP
FT                   VLLEASGTVRAVKVAPGDVVQEGDVLVEIVRS"
     atggcgcgtg agcaggtgac cgaggtcgtg gcggagatgg tggccaacgt gttgagcgtc        60
     gccgtggctc ccggtgaccc ggtcgaggcg ggggacaccg tcgtgctgct ggagtcgatg       120
     aagatggaga tcccggtact gctcgaggcg tccggcaccg tgcgggcggt caaggtcgcc       180
     ccgggcgacg tggtccagga gggcgacgtg ctcgtggaga tcgtgcgctc ctga             234
//

If you have problems or comments...

PBIL Back to PBIL home page