(data stored in ACNUC1104 zone)

EMBL: CP000509.PE181

CP000509.PE181       Location/Qualifiers
FT   CDS_pept        complement(196675..197058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79731"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD46"
FT                   /protein_id="ABL79731.1"
FT                   /translation="MTITTTGMSVALQGLRQALYSLSEPGVSLGSWRWSVRQQMAGVRD
FT                   ALLAEAEYADEGWLAARTGSVLRERTALLGRLSALGTPVLESDDVDAVCTELDRLLVDL
FT                   GRHAQRLHDLAYDEVELELGGSE"
     atgaccatca ccacgaccgg gatgtcagtc gcactgcagg gtctgcgcca ggctctctac        60
     tccctgagcg agcccggggt ctccctgggc agctggcggt ggtcggtccg ccagcagatg       120
     gcgggggtcc gcgacgccct cctcgccgag gccgagtacg ccgacgaggg ctggctggcc       180
     gcccgcacgg gcagcgtgct ccgcgagcgc acggcgctgc tcggccggct cagcgcgctc       240
     ggcaccccgg tgctcgagag cgacgacgtc gacgcggtgt gcaccgagct ggaccggctg       300
     ctggtcgacc tcggccggca cgcccagcgg ttgcacgacc tggcctacga cgaggtcgaa       360
     ctggagctcg gcggctcgga gtag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page