(data stored in ACNUC1104 zone)

EMBL: CP000509.PE186

CP000509.PE186       Location/Qualifiers
FT   CDS_pept        complement(202837..204369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0191"
FT                   /product="ATP-binding region, ATPase domain protein"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: mbu:Mbur_0510 external sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79736"
FT                   /db_xref="GOA:A1SD51"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD51"
FT                   /protein_id="ABL79736.1"
FT                   /translation="MARLLAPVNVHLAVVVVVLAMLGIFGLMSSAHTVDRLTQETTPIA
FT                   ADNAAVQRDMLILQSSTHAWVQSGQRVVLTPYRIAEARLEARMERLEEYAEPGSDLDAA
FT                   VDQQAEAVARWRAYSDARIARPGGMETYDSREFMDAKMLFDRFGLAHAATTAAFDREID
FT                   AAQHAARVVLTGTVAAMVVVGLTGLAILQYTRRRLLRALELPLRNLESVAHRLAENDTS
FT                   ARAEPVGPREVQAVTQALNTLAAAHERAVAVEERLRADQQALDSAKDDFVSNVSHELRT
FT                   PLTTLNGYLEMVHDEFEGRLSPRHQKMMDTSQRNVDRLKTLIEDLLTLSRSETKEPARD
FT                   VVDGRELVAEVVDDLRVTAAQRAIRIAVHDELDDVPWIVGDRSQLLRALLNVVGNAVKF
FT                   SHQCGLVEVGMARQANWLTIEISDHGLGIPEDEIGRIGSRFFRGSNAISQAIGGTGLGL
FT                   RITQSIIDAHDGEIQIRSRQGAGTTVTVRLRALSTATDAEPPAASAEPCPQP"
     gtggcgaggc tcctcgctcc ggtgaatgtg cacctcgcgg tcgtggtcgt ggtcctggcg        60
     atgctgggca tcttcgggct catgtcctct gcccacacgg tcgaccggct gacccaggag       120
     accacgccga tcgccgccga caacgccgcc gtgcagaggg acatgctgat cctccagtcg       180
     agcacccatg cctgggtgca gagcgggcag cgggtggtgc tgacgcccta ccggatcgcc       240
     gaggcgcgcc tcgaggcacg catggagagg ctcgaggagt acgccgagcc cggatcggac       300
     ctcgacgctg cggtggacca gcaggccgag gcggtcgcca ggtggcgcgc ctactccgac       360
     gcgcggatcg cccggccggg cggcatggag acctacgact cacgcgagtt catggacgcc       420
     aagatgctct tcgaccgctt cggactcgcc cacgctgcga ccacggccgc cttcgatcgg       480
     gagatcgacg ccgcccaaca cgccgcccgg gtcgtgctga caggtacggt cgcggcgatg       540
     gtggtcgtcg gtctcaccgg gctggccatc ctgcagtaca cccgccggcg cctcctccgg       600
     gccctcgagc tcccgctccg caacctcgag agcgtggcgc accggctcgc cgagaacgac       660
     acctcggctc gggcggagcc ggtcggtccg cgcgaggtgc aggcggtcac gcaggctctc       720
     aacacgctcg ccgccgccca cgaacgcgct gtcgcggtgg aggagcgcct gcgggccgac       780
     cagcaggcgc tggactcggc caaggacgat ttcgtctcca acgtgtccca cgagttgcga       840
     acgcccttga ccaccctcaa cggctacctg gagatggtgc acgacgagtt cgaaggacgg       900
     ctctcgccac ggcaccagaa gatgatggac acgagccagc gcaacgtcga caggctgaag       960
     accctgatcg aggatctgtt gaccttgtct cgcagcgaga cgaaggaacc ggcgcgtgac      1020
     gtcgtcgacg ggcgagagct cgttgcggag gtggtcgacg acctccgggt gaccgcggcc      1080
     caacgagcca tcaggatcgc cgtgcacgac gagctcgacg acgtaccgtg gatcgtcggt      1140
     gaccgatcac agctcctccg agcgctgctc aacgtcgtgg gcaacgccgt gaagttcagt      1200
     catcagtgcg gtctggtcga agtgggcatg gcccggcagg cgaactggct gacgatcgag      1260
     atcagcgacc acggcctcgg catccccgag gatgagatcg gacgaatcgg aagcaggttc      1320
     ttccgcggct ccaatgcgat cagccaggcg ataggcggca ccgggctcgg ccttcggatc      1380
     acccagagca tcatcgacgc acacgacggc gagatccaga tccggtcccg gcaaggggcc      1440
     ggtacgacgg tgaccgttcg gctgagagcc ctctccaccg cgacggacgc cgaaccaccg      1500
     gctgcgtcgg cggagccctg cccccaaccc tga                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page