(data stored in ACNUC1104 zone)

EMBL: CP000509.PE187

CP000509.PE187       Location/Qualifiers
FT   CDS_pept        204621..205559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0192"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TIGRFAM: phosphate binding protein; KEGG:
FT                   tth:TTC1726 phosphate-binding protein; TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79737"
FT                   /db_xref="GOA:A1SD52"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD52"
FT                   /protein_id="ABL79737.1"
FT                   /translation="MRPRHSLLAAMAGVAITLAACGGSAEQDTDAASTGVVIVDGSSTV
FT                   YPMSEAAYQLMSGEYPDIHVSVTASGTGGGFAKFCVGETHISNASRPIDPDETKLCEEN
FT                   GVAYTELQVGIDALTVVVHPRLGVDCLTTDQLVELWRPGADVARWNDLDPSFPDQKVVL
FT                   FGPGTDSGTYDYLADVIGDPSEATRDDYESSEDDNVLVQGVAGTPGATGYFGYTYYEEY
FT                   ADALKAVAIDDGNGCVAPSARTAGTGKYTPLSRPLFIYVNDRSYAENTAVKRYTDFYIA
FT                   NLSTIAHAAQFIDLNEAQNAETREALEGMRG"
     gtgaggccac gccactccct cttggccgcg atggcagggg tcgccatcac actggcggcc        60
     tgcggaggca gcgccgaaca ggacacggac gctgcgtcga ccggggtcgt gatcgtcgac       120
     ggctcgtcca ccgtctaccc gatgagcgag gccgcctacc agctgatgag cggggagtac       180
     cccgacatcc acgtgagcgt cacggcgtcg ggcaccggag gcggcttcgc gaagttctgc       240
     gtcggcgaga cccatatctc caatgcgtcg cgaccgatcg acccggacga aacgaagctc       300
     tgcgaggaga acggtgttgc gtacaccgag ctccaggtcg ggatcgatgc gttgactgtc       360
     gtcgtccacc cgcggctcgg cgtggactgc ctcacgaccg accagctggt cgagctctgg       420
     cgaccgggag cggacgtcgc tcgctggaac gacctcgacc cgagttttcc ggaccagaag       480
     gtggtcctgt tcggccccgg cacggactcc ggcacctacg actacctagc ggacgtcatc       540
     ggggacccct cggaggcgac ccgagacgac tacgagtcct ccgaggacga caacgtcctg       600
     gtccagggtg tcgccggtac cccgggtgcc acgggctact tcgggtacac ctactacgag       660
     gagtacgccg atgcgctcaa ggcggtcgcc atcgacgacg ggaacggctg cgtcgcaccc       720
     tcggccagga cggccggcac cggcaagtac acaccgctgt cgcgcccgct cttcatctac       780
     gtcaacgatc ggtcctatgc cgagaacacc gcggtgaagc gctacacgga cttctacatc       840
     gcgaacctca gcacgatcgc tcacgcggct cagttcatcg acctgaacga agcccaaaac       900
     gccgagaccc gcgaggccct ggagggcatg cgcggttga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page