(data stored in ACNUC1104 zone)

EMBL: CP000509.PE188

CP000509.PE188       Location/Qualifiers
FT   CDS_pept        205714..206400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_3061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79738"
FT                   /db_xref="GOA:A1SD53"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD53"
FT                   /protein_id="ABL79738.1"
FT                   /translation="MLAVGLPMLAAGTALARRGSVRGLVLWLGAAAYLAYQGVMFCFGT
FT                   PINALFLAYVALLGLGVWSLAALVAVTRNPTVCSAPGAGTPWRPVAGLLGAFAVLNGLA
FT                   WLARVAPVTWTGDPPEALAGSGLLTSPVWVQDLAFWIPAGMVLSALTWRRHPRAAVLAG
FT                   GMLAFYVVECVSVASDQWWGVRADPDHPAVASMSAVPGSLAVAALAAVPLLWLLARLHG
FT                   AARATG"
     gtgctggcgg tcgggctgcc gatgctggcg gcggggaccg cgctggcccg ccgcgggtcg        60
     gtccgcggcc tggtcctctg gctgggtgcg gcggcgtacc tggcctacca gggcgtgatg       120
     ttctgcttcg ggaccccgat caacgcgctg ttcctggcgt acgtcgccct gctcggtctc       180
     ggcgtgtggt cgctcgccgc cctcgtggcg gtcactcgga acccgacggt ctgctccgca       240
     ccgggcgccg gcaccccgtg gcggccggtg gccgggctgc tgggagcgtt cgccgtgctg       300
     aacgggctgg cctggctggc tcgggtcgcg ccggtcacgt ggaccggcga cccgccggag       360
     gcgctggccg ggagcggcct actgaccagc ccggtgtggg tgcaggacct ggcgttctgg       420
     atcccggccg ggatggtgct gtcggcgctg acgtggcggc gccacccgcg cgcggccgta       480
     ctggccggcg ggatgctcgc gttctacgtc gtcgagtgcg tcagcgtggc cagcgaccaa       540
     tggtggggcg tgcgtgccga tcccgaccat ccggcggtgg cctcgatgag tgccgtgccc       600
     ggaagcctgg ccgtggccgc gctcgccgcc gtaccgttgc tctggctgct ggcccgcctc       660
     cacggcgccg cccgagccac cggctga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page