(data stored in ACNUC1104 zone)

EMBL: CP000509.PE191

CP000509.PE191       Location/Qualifiers
FT   CDS_pept        complement(208506..209549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0196"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: dge:Dgeo_2243
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79741"
FT                   /db_xref="GOA:A1SD56"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD56"
FT                   /protein_id="ABL79741.1"
FT                   /translation="MAKVTLQSIADRVGVSRMTVSNAFSRPDQLSGELRERILAAADEL
FT                   GYVGPDPAARALARGRTGSVGLLLTDELGEAFQDAVATQFLTSVADALTHEGLAVTLLT
FT                   SGGAAGAPSDYVPARDVAMDGAIVYICDPASPDIAWLERRGLPLVSVDREPAPDAPSVN
FT                   VDDRAGARAAAEHLIELGHTRVAIITLRSTFDVAGVPTANRPASERMTGWREALEAAGI
FT                   EPVVAAAAFRPRPSVEEIARDLLDRPDRPTAVLCFSDAFAVTTIQVAESLGLRVPEDLS
FT                   VVGYDDSPLATAIRPQLTTVHQEVARKGQEAVRSLMAIMGPDRPDPVERILLPTALVVR
FT                   DSTAPPP"
     atggccaagg tgaccctcca gtcgatcgcc gaccgcgtcg gcgtcagccg gatgacggtc        60
     tccaacgcgt tctcccggcc cgatcagctc tccggtgagc tgcgcgagcg gatccttgcg       120
     gccgccgacg agctcgggta cgtcggcccc gacccggccg cacgcgccct cgcccggggc       180
     cggaccggct cggtcggcct gctgctcacc gacgagctcg gcgaggcgtt ccaggacgcc       240
     gtcgcgaccc agtttttgac ctcggtcgcc gacgcgctca cccacgaggg gctggccgtc       300
     acgctgctca cctcgggtgg cgcggccggg gcgccgtcgg actacgtgcc ggcccgcgac       360
     gtcgcgatgg acggcgcgat cgtctacatc tgcgaccccg cctcgcccga catcgcgtgg       420
     ctcgagcggc gcggcctgcc gctggtctcc gtcgaccgcg agccggcccc ggacgccccc       480
     agtgtcaacg tcgacgaccg cgcgggggcc cgcgcggcgg ccgagcacct gatcgagctc       540
     gggcacacgc gggtcgcgat catcaccctg cgcagcacct tcgacgtcgc cggggtgccg       600
     acggccaacc ggcccgccag cgagcggatg accggctggc gcgaggccct cgaggccgcc       660
     ggcatcgagc cggtggtggc cgccgccgcc ttccggcccc ggccctcggt cgaggagatc       720
     gcgcgcgacc tgctcgaccg gccggaccgt ccgaccgcgg tgctgtgctt ctccgacgcg       780
     ttcgcggtca ccacgatcca ggtcgcggag tcactgggcc tgcgcgtgcc cgaggacctg       840
     tcggtggtcg ggtacgacga ctccccgctc gcgacagcca tccggcctca gctcaccacc       900
     gtgcaccagg aggtggccag gaagggtcag gaggcggtgc gctccctgat ggcgatcatg       960
     gggccggacc gtccggaccc ggtcgagcgg atcctgctgc cgaccgcgct cgtggtgcgc      1020
     gacagcaccg cgccgccgcc ctga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page