(data stored in ACNUC1104 zone)

EMBL: CP000509.PE192

CP000509.PE192       Location/Qualifiers
FT   CDS_pept        complement(209959..212736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0197"
FT                   /product="alpha amylase, catalytic region"
FT                   /note="PFAM: alpha amylase, catalytic region; SMART: alpha
FT                   amylase, catalytic sub domain; KEGG: sco:SCO2226
FT                   bi-functional protein (secreted alpha-amylase/dextrinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79742"
FT                   /db_xref="GOA:A1SD57"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD57"
FT                   /protein_id="ABL79742.1"
FT                   /translation="MRQLISAPLVLAGAMTLGVTLAAPAGAAAPARADGPGHRPSAYAQ
FT                   HAPRPGVTDEDFYFVMGDRFENGDPDNDRGGLTGDRLTTGFDPAAKGFYNGGDLDGLRS
FT                   RLDYIQGLGTDSIWLTPIFKNKPVQLEDGPSAGYHGYWITDFTTVDPHLGTNQDLADLV
FT                   DAAHDRGMKVYFDIITNHTADVIGYEEGDRTAYVSKDAVPYRDAAGNPFDDRDYAGTSQ
FT                   FPVLDPATSFPYTPVLDAGEQDLKVPAWLNDLTNYHNRGNTTFSGEDSQYGDFFGLDDL
FT                   FTEKPAVVDGMIDIYRTWVEDFDIDGFRIDTMKHVDDAFWQRFGPTMQQLAAADGNPGF
FT                   FMFGEVALDGSDAAAKAFTSRYTTTDRMQAVLDFPFQDAARGFASKSLDSDRLARFFRN
FT                   DDWYTDADSNAYSLPTFLGNHDMGRIGHFLEADNPGADDAELVARDRLAHELMYLSRGN
FT                   PVVYYGDEQGFTGDGGDQLARQTMFASQVPEYRDDDQIGTDRTGADDNFVTDAPLYRAI
FT                   RDLADLTERDPALRDGAQQVRYSSPGAGLFAFSRVDREHRVEYVVALNNSEQADSGRVP
FT                   TYLKKGEFRKVYGPGPARLVSRADRGLDVALPALSTSVYRSVDRIPRAERAPQISVARP
FT                   VPSSIAHGRMHVRAKVSGSSFYEVTFQRRIGDGAWQTIGVDDNAPYQVFDDVADQTPGT
FT                   AVSYRAAVLDNAGHTRGSRARTTAVPRTSVVVTGPADGGTVSVVDPVTVTASVDPERPL
FT                   QSVAFERSVGDGPWTSLGTDSSAAAYTVTDDVSDLPLGTEVRYRATLSEAGVVQGTSAP
FT                   VRVTTAEPAPAVDSVTVAGSLQSELGCPEDWQPGCAATHLTFDRTDGRWHGTFTVPAGD
FT                   YEWKVAINDSWDVNYGAGGAAGGSNLALPVPAGGATYVFTWDQVSHEPSVAPAG"
     atgcgccaac tgatttccgc accgctcgtc ctcgcggggg ccatgaccct cggcgtcacc        60
     ctcgcggccc cggccggcgc cgcggctcct gcacgagcgg acgggccggg ccaccgcccc       120
     tcggcgtacg cccagcacgc cccgcgcccc ggtgtcaccg acgaggactt ctacttcgtc       180
     atgggcgacc ggttcgagaa cggcgacccg gacaacgatc gcggcggcct caccggcgac       240
     cggctcacca ccggcttcga cccggccgcc aaggggttct acaacggcgg ggacctggac       300
     gggctgcgct cccggctgga ctacatccag ggcctcggca ccgactcgat ctggctgacg       360
     ccgatcttca agaacaagcc ggtccagctc gaggacggac cgtcggccgg ctatcacggc       420
     tactggatca ccgacttcac caccgtcgac ccgcacctgg gcaccaacca ggacctcgcc       480
     gacctcgtgg acgccgccca cgaccggggg atgaaggtct acttcgacat catcaccaac       540
     cacacggccg acgtgatcgg ctacgaggag ggcgaccgca cggcgtacgt ctccaaggac       600
     gcggtgccct accgcgacgc cgccggcaac cccttcgacg accgcgacta cgccggcacc       660
     tcgcagttcc cggtgctgga cccggccacg tccttcccgt acaccccggt gctcgacgcg       720
     ggcgagcagg acctcaaggt gccggcctgg ctcaatgacc tgacgaacta ccacaaccgc       780
     ggcaacacga cgttctccgg cgaggacagc cagtacggcg acttcttcgg cctcgacgac       840
     ctgttcaccg agaagccggc ggtggtcgac gggatgatcg acatctaccg cacctgggtc       900
     gaggacttcg acatcgacgg cttccggatc gacacgatga agcacgtcga cgacgcgttc       960
     tggcagcggt tcggtccgac catgcagcag ctcgccgcgg ccgacggcaa ccccgggttc      1020
     ttcatgttcg gagaggtcgc cctcgacggc agcgacgccg ccgccaaggc gttcacctcg      1080
     cgctacacca ccaccgatcg gatgcaggcg gtgctggact tcccgttcca ggacgccgcc      1140
     cgggggttcg cgtcgaagag cctcgacagc gacaggctgg cgcggttctt ccgcaacgac      1200
     gactggtaca cggacgcgga ctcgaacgcc tactcgctgc cgaccttcct cggcaatcac      1260
     gacatgggcc ggatcgggca cttcctggag gccgacaacc ccggcgccga cgacgccgaa      1320
     ctggtggcgc gcgaccggct ggcccacgag ctgatgtacc tctcccgggg caacccggtc      1380
     gtctactacg gcgacgagca gggcttcacc ggcgacggcg gggaccagct cgcccggcag      1440
     acgatgttcg ccagccaggt gccggagtac cgggacgacg accagatcgg caccgaccgc      1500
     accggcgccg acgacaactt cgtcaccgac gccccgctgt accgagcgat ccgggacctc      1560
     gccgacctga ccgagcggga cccggccctg cgcgacgggg cgcagcaggt ccgctactcc      1620
     tcgccgggcg ccgggctgtt cgcgttctcg cgggtcgacc gcgagcatcg ggtcgagtac      1680
     gtcgtggcgc tgaacaacag cgagcaggcc gactcggggc gggtgccgac gtacctcaag      1740
     aagggcgagt tccggaaggt gtacgggccg gggccggccc gcctggtgag ccgcgcggac      1800
     cggggcctgg acgtcgcgct cccggcgctg tcgacctccg tctaccgctc ggtcgaccgg      1860
     atcccccgcg ccgagcgcgc tccgcagatc tcggtggccc ggccggtgcc gtcgtcgatc      1920
     gcgcacggcc ggatgcacgt gcgggccaag gtgtcgggct cctcgttcta cgaggtgacc      1980
     ttccaacgcc gcatcggcga cggtgcctgg cagacgatcg gggtcgacga caacgcgccg      2040
     taccaggtgt tcgacgacgt cgccgaccag accccgggga cggccgtgag ctatcgggcc      2100
     gccgtgctcg acaacgccgg gcacacccgc gggtcccggg cccgcaccac cgcggtgcca      2160
     cggacctccg tggtggtgac gggcccggcc gacggcggca cggtcagcgt ggtcgacccg      2220
     gtgaccgtga ccgcctcggt cgacccggag cggccgctgc agtcggtggc gttcgagcgc      2280
     agcgtcggcg atgggccctg gacgagcctg ggcaccgaca gctccgctgc ggcctacacc      2340
     gtgaccgacg acgtgtcgga cctgccgctc ggcaccgagg tgcgctaccg ggccacgctc      2400
     agcgaggccg gcgtcgtgca gggcacgagc gccccggtca gggtgaccac cgccgagccc      2460
     gcgccggcgg tcgactcggt gacggtcgcc ggcagcctgc agtccgagct cggctgcccc      2520
     gaggactggc agcccggctg cgctgccacg cacctgacct tcgatcgcac cgacgggcgc      2580
     tggcacggca ccttcaccgt gcccgccggc gactacgagt ggaaggtcgc gatcaacgac      2640
     tcctgggacg tcaactacgg tgcgggtggc gccgccggcg gcagcaacct cgccctcccg      2700
     gtcccggccg gtggcgcgac gtacgtgttc acctgggacc aggtcagcca cgagccctcg      2760
     gtcgcaccag ccggctga                                                    2778
//

If you have problems or comments...

PBIL Back to PBIL home page