(data stored in ACNUC1104 zone)

EMBL: CP000509.PE193

CP000509.PE193       Location/Qualifiers
FT   CDS_pept        complement(212830..214140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0198"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: sil:SPO1469
FT                   3-ketosteroid dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79743"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD58"
FT                   /protein_id="ABL79743.1"
FT                   /translation="MERIEVDVAVVGAGACGVLTALRAAEDPDLVIGVFEKSTREGCNA
FT                   EISSGSLAAGGTRFQRAAGIDDSPARHAEDILAASGDTAAASVVEALCAAAPQYVEWLA
FT                   DRLGYPIEIGTDLPRAGMSVPRLHSDVGRQGGRRLMRHLRDALAARPNVALVDEAPAMR
FT                   LTASADGRVTGLVVEQNHTEIEASASTVVLALDGFAANPALMKEHCAALGDPFYGGVST
FT                   STGDAVAWLTELGADFRNMGACLRSGLVVVGHGTRVSPSLPFYGAVLLDLEGRRFVDEE
FT                   AHGYSSLAGLLQGLPAQRAALVWDAEAHAATRESELMRETIRAVGFTTYDDRAGLAAAL
FT                   GADPELEPLPGRRRLAPPYHLAWVTHGVLATQGGAVVDPRGQVLRPDGSAIPGLRAGGG
FT                   TAAGLAGPDSSGYSSGNGLLSAFGMGWIVGTELAGGR"
     gtggagcgga tcgaggtcga cgtcgcggtc gtcggcgccg gcgcctgcgg cgtgctgacc        60
     gcgctgcgtg cggccgagga cccggacctc gtcatcgggg tcttcgagaa gagcacccgc       120
     gagggctgca acgccgagat ctccagcggc agcctcgccg ccggcggcac ccgcttccag       180
     cgtgccgccg gcatcgacga ctcccccgcc cggcacgccg aggacatcct cgcggccagc       240
     ggcgacaccg ccgcggcctc cgtcgtcgag gcgctgtgcg cggccgcccc gcagtacgtc       300
     gagtggctcg ccgaccggct cggctacccg atcgagatcg gcaccgacct gccgcgcgcc       360
     ggcatgtccg tgccgcggct gcacagcgac gtcggccgcc agggcgggcg ccgactgatg       420
     cggcacctgc gcgacgcact cgctgcccgg ccgaacgtcg ccctggtcga cgaggcgccc       480
     gccatgcgcc tgaccgcctc ggccgacggg cgggtcacgg gcctggtggt cgagcagaac       540
     cacaccgaga tcgaggcctc cgcctcgacc gtcgtgctcg cgctggacgg cttcgcggcc       600
     aacccggccc tgatgaagga gcactgcgcg gcgctgggcg acccgttcta cggcggggtg       660
     tcgaccagca ccggcgacgc cgtcgcgtgg ctcaccgagc tcggcgccga cttccggaac       720
     atgggtgcct gcctgcgctc cggcctggtg gtcgtcgggc acggcacccg ggtcagcccg       780
     tcgctgccgt tctacggcgc ggtgctgctc gacctcgagg gtcgccggtt cgtcgacgag       840
     gaggcgcacg gctactccag cctggccggg ctgctccagg ggctgccggc ccagcgggcg       900
     gcgctggtct gggacgccga ggcgcacgcc gccacccggg agtccgagct gatgcgcgag       960
     acgatccgcg ccgtcggctt cacgacgtac gacgaccggg ccggcctggc cgcggcgctg      1020
     ggcgcggacc ccgagctcga gccgctgccc gggcgccggc gcctggcgcc gccgtaccac      1080
     ctggcctggg tgacccacgg cgtgctggcc acccagggcg gcgccgtggt cgacccgcgc      1140
     gggcaggtgc tgcgccccga cggctcggcg atcccgggac tgcgcgccgg cggcgggacg      1200
     gccgccgggc tcgccggccc ggactcgagc ggctacagct ccggcaacgg gctgctctcg      1260
     gcgttcggca tgggctggat cgtcggcacc gagctggccg gcggccgctg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page