(data stored in ACNUC1104 zone)

EMBL: CP000509.PE195

CP000509.PE195       Location/Qualifiers
FT   CDS_pept        complement(214931..216397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0200"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: bxe:Bxe_B1003 putative succinate
FT                   dehydrogenase/fumarate reductase, flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79745"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD60"
FT                   /protein_id="ABL79745.1"
FT                   /translation="MSAPVAEYDVVVVGGGVAGLSAACAAAEAGARVVLLERSTEAETG
FT                   GNTRYTEAFLRMRSLEETADGLEDALVDDFMGHPDPSVVRDAALPAERRSALYRAHHVV
FT                   DPDYVATFAAEAPETLAWMGGHGMRFEFLPTPFLTTSTTRMAPVGGGLAIVETMGKAAR
FT                   GLGVEFRFETTARRLLTDPDGRAGVAGVLAHTPTGPVELRGRVVLASGGYQGNAELMAR
FT                   YHGERGLTTRPVARGGNHNKGEGLEMALALGAATAGNFSLFHAEPVDPRSGEPEAAIFC
FT                   FPYGILVNREGRRFVDEARGPVDAWYERTTRDIQAQTEGVAWVILDQQGLAVPNIRSGI
FT                   RTDQAPVTADTLEALAERIGVPADTLVATVASYNSACRDGAFDHTAPDGLATSGLVPPK
FT                   SNWARPIAEGPFEAYPIMAANVFTFGGLKTTPAAEVVDRDGRPIPGLYAAGELTGLYYS
FT                   NYTGSTSVLRGATFGRIAGSAAAATIGVGA"
     gtgagcgccc ccgtggcgga gtacgacgtc gtcgtggtcg gcggcggggt cgccggcctg        60
     tccgcggcct gcgctgccgc cgaggccggc gcgcgggtgg tgctgctgga gcgctcgacc       120
     gaggccgaga ccggcggcaa cacccgctac accgaggcgt tcttgcggat gcgctcgctc       180
     gaggagacgg cagacgggct cgaggacgcc ctggtcgacg acttcatggg ccacccggac       240
     ccgagcgtgg tgcgcgacgc cgcgctgccg gccgagcgcc gctccgccct ctaccgcgcc       300
     caccacgtcg tcgaccccga ctacgtcgcg accttcgccg ccgaggcgcc cgagacgttg       360
     gcctggatgg gcgggcacgg gatgcgcttc gagttcctgc cgaccccgtt cctgaccacc       420
     tcgaccaccc ggatggcgcc ggtcggcggc ggcctggcga tcgtcgagac gatgggcaag       480
     gccgcccgcg gcctcggcgt cgagttccgc ttcgagacga ccgcgcgccg gctgctcacc       540
     gaccccgacg gcagggcggg ggtggccggg gtgctcgccc acacgcccac cggaccggtg       600
     gagctgcgcg gccgggtcgt gctcgcgtcg ggcggctacc agggcaacgc cgagctgatg       660
     gcgcgctacc acggcgagcg cgggctgacc acgcgccccg tcgcccgcgg cggcaaccac       720
     aacaagggcg agggcctgga gatggcgctc gcgctcggcg ctgcgacggc cggcaacttc       780
     tcgctcttcc acgccgagcc ggtggacccg cgctcgggcg agcccgaggc cgcgatcttc       840
     tgcttcccct acgggatcct ggtcaaccgc gagggccgcc gcttcgtcga cgaggcccgc       900
     gggccggtcg acgcgtggta cgagcgcacc acccgcgaca tccaagccca gaccgagggc       960
     gtcgcctggg tgatcctcga ccagcagggc ctggcggtgc cgaacatccg ctccggcatc      1020
     cgcaccgacc aggcgccggt gaccgccgac accctggagg cgctcgccga gcgcatcgga      1080
     gtccccgcgg acacgctggt cgcgacggtc gcgtcgtaca actcagcctg ccgcgacggg      1140
     gcgttcgacc acacggcccc cgacgggctg gccacctccg gcctggtgcc gccgaagtcg      1200
     aactgggcgc gcccgatcgc cgagggaccc ttcgaggcct acccgatcat ggccgccaac      1260
     gtgttcacgt tcggcgggct gaagaccacc ccggcggccg aggtggtcga ccgcgacggg      1320
     cgcccgatcc ccggcctgta cgccgccggc gagctcaccg ggctctacta ctccaactac      1380
     accggctcga cgtcggtgct gcgcggcgcg acgttcggcc ggatcgcggg cagcgcggcc      1440
     gcggccacca tcggggtcgg cgcatga                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page