(data stored in ACNUC1104 zone)

EMBL: CP000509.PE198

CP000509.PE198       Location/Qualifiers
FT   CDS_pept        complement(217732..219144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0203"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: bbr:BB3064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79748"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD63"
FT                   /protein_id="ABL79748.1"
FT                   /translation="MIPGLPIEGELPDRVGVLVLGSGLAGCAALLAAAEAGQYAVLLEK
FT                   TGAIGGSTVRSAGLSAFAGTPEQVAQGIGDSVELLKKDLMETGRHVCDEALVDLYCAHQ
FT                   LETYEWLTGHGVRYGEVHAASGQSVPRSHPTDTTGMLVTLLKAAGRLGARILLDTAAER
FT                   LVREGGQVIGVDVRTADGSRRRILADAVVLATGGFARSPELLTRFAPQMANALTAGGDG
FT                   CTGDGLLMGWQLGAGVVDTPYVKGTYGIFHEAHPDEDGTGILAVYKGAIAVNREGRRFV
FT                   DESLPYKEIGDAALAQPGVTTWQVFDAGVMAQSNDEVPIYEFAGRDRAGMLLKADTVEG
FT                   LEALVGLPDGSLVATVADYNARIADGRPDPLGRAHLSGGVDTPTPLDRPPFYAHPSRTV
FT                   VLATYCGLTVDTRLRVLDVFGEPIERLYAAGEVIGGFHGGGYMTGTSIGKAGIFGRLAG
FT                   QHAAAEESELTW"
     gtgatccccg gcctgccgat cgagggcgag ctgcccgacc gggtcggtgt actcgtgctc        60
     ggcagcgggc tcgccgggtg cgccgccctg ctcgccgcgg ctgaggccgg tcagtacgcc       120
     gtgctcctgg agaagaccgg cgccatcggc ggcagcacgg tccgctccgc cgggctctcc       180
     gcgttcgcgg gcactccgga gcaggtggcc caggggatcg gcgactcggt ggagctgctc       240
     aagaaggacc tgatggagac cgggcggcac gtctgcgacg aggcgctggt cgacctgtac       300
     tgcgcgcacc agctcgagac ctacgagtgg ctgaccgggc acggcgtccg gtacggcgag       360
     gtgcacgccg cgtccggcca gtcggtcccg cgctcgcacc ccaccgacac caccgggatg       420
     ctggtcaccc tgctcaaggc ggccggccgg ctgggtgccc ggatcctcct cgacacggcc       480
     gccgagcggc tggtccgcga gggcggccaa gtgatcggcg tcgacgtgcg caccgcggac       540
     ggcagccgcc ggcggatcct cgccgacgcg gtcgtgctcg ccaccggcgg cttcgcgcgc       600
     agcccggagc tgctcacccg gttcgcgccg cagatggcga acgcgctcac cgcgggcggc       660
     gacgggtgca ccggcgacgg cctgctgatg ggctggcagc tcggggcggg ggtcgtggac       720
     acgccgtacg tcaaggggac ctacgggatc ttccacgagg cccaccccga cgaggacggc       780
     accggcatcc tcgcggtcta caagggcgcg atcgcggtca accgcgaggg acgccgcttc       840
     gtcgacgagt ccctgcccta caaggagatc ggcgacgcgg ccctggccca gccgggcgtc       900
     acgacctggc aggtcttcga cgccggcgtg atggcccaga gcaacgacga ggtgccgatc       960
     tacgagttcg cgggccgcga ccgggccggc atgctgctca aggccgacac ggtcgagggg      1020
     ctcgaggcgc tggtgggcct cccggacggc tcactcgtcg cgaccgtcgc cgactacaac      1080
     gcccggatcg ccgatggccg gcccgacccg ctgggccgcg cccacctctc cggcggcgtg      1140
     gatacgccga ccccgctcga ccggcccccg ttctacgccc acccgtcgcg gaccgtcgtg      1200
     ctcgcgacgt actgcggcct cacggtggac acccggctgc gcgtgctcga cgtgttcggg      1260
     gagccgatcg agcgcctcta cgccgcgggc gaggtgatcg gcgggttcca cggcggcggc      1320
     tacatgaccg gcacgtcgat cggcaaggcc ggcatcttcg gccgcctggc cgggcagcac      1380
     gccgcggccg aggagagcga gctgacatgg tga                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page