(data stored in ACNUC1104 zone)

EMBL: CP000509.PE20

CP000509.PE20        Location/Qualifiers
FT   CDS_pept        complement(22374..22832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79570"
FT                   /db_xref="GOA:A1SCN5"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN5"
FT                   /protein_id="ABL79570.1"
FT                   /translation="MAKAKLDPLAPARGPLLSVRSVIALVLIVLGIAWMAYFYIVVRVD
FT                   PTAFPKPDPGSPAFMDDLGDWNYLIGFGLFLLGLVVAAHPSTPLGRGRGVVVGMLGCFL
FT                   IGLLWISAYYVFSNDLSDIPVFNDLGQKNLFVGIAFMAVGFTFATRWE"
     gtggccaagg ccaagctcga tcctctcgcc cctgcccggg gcccgctgct gtccgtgcgc        60
     tcggtgatcg cgctggtgct gatcgtgctg ggcatcgcgt ggatggccta cttctacatc       120
     gtcgtccggg tggacccgac cgcgttcccg aagcccgacc cgggctcgcc ggcgttcatg       180
     gacgacctcg gcgactggaa ctacctgatc ggcttcggcc tgttcctgct gggcctggtc       240
     gtcgccgccc acccctccac cccgctcggc cgcggtcgcg gcgtcgtcgt cggcatgctg       300
     ggctgcttcc tcatcggcct gctgtggatc agcgcctact acgtcttcag caacgacctg       360
     tccgacatcc cggtcttcaa cgacctgggg cagaagaacc tcttcgtcgg catcgccttc       420
     atggccgtcg gcttcacctt cgccacccgc tgggagtga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page