(data stored in ACNUC1104 zone)

EMBL: CP000509.PE200

CP000509.PE200       Location/Qualifiers
FT   CDS_pept        complement(220244..221431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0205"
FT                   /product="RNAse Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="KEGG: rme:Rmet_5998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79750"
FT                   /db_xref="GOA:A1SD65"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD65"
FT                   /protein_id="ABL79750.1"
FT                   /translation="MCATPDRPISRRGLLHTGGLATAAIAASSALPPTRAEAATVRRST
FT                   RATRDYRTKVVLLGTSGGPIWWRGSTRRGTSSAVVVGDAQYIVDLGAGALGSVRDAGLL
FT                   GSADGKNDLHALRGVFLTHLHSDHVSDYPTLVIEGWIGGGLGDAERALQVYGPGRRDAL
FT                   PHTFPAGRPEPSPVIPDNPGPGTVEMTESLFAAFATDINDRVFDSASPDIRSRIQPHDI
FT                   ALPADVAAPEAGAVPRMSPFSVYEDDRVRVTATLVDHGQMLPSFGYRFDTEDGSVVISG
FT                   DTTVSENLVELAADCDVLVHEVIDQAWVEESISALPAPDEVKAAYKNHMLGAHTTIPQV
FT                   ARVATEAGARTLVLHHFVPGHLPERRWRRVSRNFAGELVVGQDLQRIGVGRRRRG"
     atgtgcgcga ctccagaccg tccgatcagc cgccgcggcc tcctgcacac gggcggcctc        60
     gccaccgccg cgatcgccgc cagcagcgcg ctcccaccca cgcgcgccga ggccgcgacc       120
     gtacgtcgca gcacccgggc cacccgcgac taccggacca aggtcgtcct gctggggacc       180
     tccggggggc cgatctggtg gcgcggctcg acgcgacgcg gcacgtcgtc cgcggtggtc       240
     gtcggcgatg cgcagtacat cgtggacctc ggcgccgggg cgctcggctc ggtgcgggac       300
     gcgggactgc tcggcagtgc cgacggcaag aacgacctgc acgcgctgcg cggcgtgttc       360
     ttgacccacc tgcactccga ccacgtcagc gactacccga cgctggtgat cgaggggtgg       420
     atcggaggcg gcctcggcga cgccgagcgg gccctccagg tctacggccc ggggcggcgc       480
     gacgcgctgc cgcacacctt cccggcgggc cgaccggagc cgagcccggt catccccgac       540
     aacccgggcc cgggcacggt cgagatgacc gagtcgcttt tcgccgcctt cgccaccgac       600
     atcaacgacc gggtcttcga ctcggcatcc cccgacatcc gtagccgcat ccagccgcac       660
     gacatcgcgc tgcccgcgga cgtggccgcg ccggaggccg gggcggtccc gcgcatgtcg       720
     ccgttctcgg tctacgagga cgatcgggtg cgggtcaccg cgacgctcgt ggatcacggc       780
     cagatgctgc cgtcgttcgg ctaccggttc gacaccgagg acgggtcggt cgtgatctcg       840
     ggcgacacga cggtgtcgga gaacctggtc gagctcgccg cggactgcga cgtcctggtc       900
     cacgaggtga tcgaccaggc ctgggtcgag gagagcatct ccgccctccc cgcgcccgac       960
     gaggtcaagg ctgcctacaa gaaccacatg ctgggtgccc acaccacgat cccgcaggtg      1020
     gcccgagtgg cgaccgaggc cggcgcccgc acgctcgtgc tgcaccactt cgtgccgggc      1080
     cacctccccg agcgccgctg gcgccgcgtc tcccggaact tcgccggaga gctcgtcgtc      1140
     gggcaggacc tgcagcggat cggcgtcggc cggcgccgtc gcggatga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page