(data stored in ACNUC1104 zone)

EMBL: CP000509.PE201

CP000509.PE201       Location/Qualifiers
FT   CDS_pept        221618..222793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0206"
FT                   /product="Acyl-CoA dehydrogenase, type 2, C-terminal
FT                   domain"
FT                   /note="PFAM: Acyl-CoA dehydrogenase, type 2, C-terminal
FT                   domain; KEGG: nfa:nfa33590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79751"
FT                   /db_xref="GOA:A1SD66"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD66"
FT                   /protein_id="ABL79751.1"
FT                   /translation="MTVLDEIRRLEPEFRAGEEEAAELRRLPDQTWKQMLESGLLRGLQ
FT                   PRRWGGGELSLREHLTGVYELGRIAPSAGWVSGVVGSHPWQVALYDEETQQEVWGEDPT
FT                   FLPSSSYAPTGKIVPVDGGYRVSGRWSFSSGSDHCQGVILGGFAGTIEVAPGVEVPNFG
FT                   SALLLRDQYVIEDTWHVAGSRGTGSKDIVVDDAFLPARRFLSSPLYEYNADRPAPGIAT
FT                   NPNPLYQVPWAVMFNLVLVAPMLGLGRRFLDDWTAETTTRRANWGGMVKDDALMQMHLA
FT                   EAEWVHDAAVKKMYDAIDTITEAAEAGVRLDKRERARMRWNITRGCQQVGFAINDLMRV
FT                   ASGRTVFTSHPLHRLYQDVTAELGHAFLVSDGVGQYYGASLLDSSAPEVML"
     atgacagtcc tcgacgagat ccgtcggctc gagcccgagt tccgggccgg cgaggaggag        60
     gccgccgagc tgcgccgcct ccccgaccag acctggaagc agatgctgga gagcggcctg       120
     ctccgcggcc tccagccccg gcgctggggt ggcggcgagc tgtcgctgcg cgagcacctg       180
     accggggtct acgagctcgg ccggatcgcc ccgtccgcgg gctgggtctc cggcgtcgtc       240
     ggctcgcacc cctggcaggt ggcgctctac gacgaggaga cccagcagga ggtgtggggc       300
     gaggacccga cgttcctgcc gtcctcctcc tacgcgccga ccggcaagat cgtgccggtc       360
     gacggcggct accgggtcag cggccgctgg tcgttctcct ccggcagcga ccactgccag       420
     ggcgtgatcc tgggcggctt cgccggcacc atcgaggtcg cgccgggcgt cgaggtcccc       480
     aacttcggct cggcgctgct gctgcgcgac cagtacgtca tcgaggacac ctggcacgtc       540
     gccggcagcc gcgggaccgg cagcaaggac atcgtggtcg acgacgcgtt cctgccggcc       600
     cgccggttcc tctccagccc gctctacgag tacaacgccg accggcccgc gccggggatc       660
     gcgaccaacc cgaacccgct ctaccaggtg ccgtgggcgg tcatgttcaa cctggtgctg       720
     gtcgcaccga tgctcggact cggccgccgc ttcctcgacg actggaccgc cgagaccacc       780
     acccggcgcg ccaactgggg cggcatggtc aaggacgacg cgctgatgca gatgcacctg       840
     gccgaggcgg agtgggtcca cgacgccgcg gtcaagaaga tgtacgacgc catcgacacg       900
     atcaccgagg ctgcggaggc cggcgtacgc ctcgacaagc gcgagcgggc ccggatgcgc       960
     tggaacatca cccgcggctg ccagcaggtc gggttcgcca tcaacgacct gatgcgcgtc      1020
     gccagcggtc gcaccgtctt caccagtcac cccctgcacc gcctctacca ggacgtcacg      1080
     gccgagctcg gccacgcgtt cctggtctcc gacggcgtcg gccagtacta cggcgcctcc      1140
     cttctcgact cgtccgctcc ggaggtcatg ctgtga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page