(data stored in ACNUC1104 zone)

EMBL: CP000509.PE202

CP000509.PE202       Location/Qualifiers
FT   CDS_pept        222790..223707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0207"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mmc:Mmcs_1630
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79752"
FT                   /db_xref="GOA:A1SD67"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD67"
FT                   /protein_id="ABL79752.1"
FT                   /translation="MITQLAYLGIASPNYQQWRDYGTRLLGTQLAADGPDGAVRLRVDD
FT                   KGYRIAVHPAEQDEFRYAGWACHNETELRSYVAELRGKGLEVHEGTPEELKERQVAELY
FT                   WIQDPWGNRHELVWGQFSMPNSFWPARKMNGFVTGDLGLGHIVMIVPDLQAADAFYAET
FT                   LGFRLSDRVVSDIFNLRFYHCNGRHHSLAVAEIPGMTGINHLMLEVENMDDLGSAIDLF
FT                   TADQEREILLSLGRHTNDLMTSIYVQTPSSMQIEYGFGGIAVDDLTWVAGTHDVPSIWG
FT                   HHRSQAYLDGPPGIFQMLDAEAPA"
     gtgatcactc aactcgccta cctggggatc gcctccccga actaccagca gtggcgcgac        60
     tacggcaccc gcctgctcgg cacccagctc gccgcggacg gcccggacgg cgcggtgcgc       120
     ctgcgggtcg acgacaaggg ctaccggatc gcggtccacc ccgcggagca ggacgagttc       180
     cggtacgccg gctgggcctg ccacaacgag accgagctgc gcagctacgt cgccgagctg       240
     cgcggcaagg gcctcgaggt gcacgagggc acgcccgagg agctcaagga gcgccaggtg       300
     gcggagctct actggatcca ggacccgtgg gggaaccggc acgagctggt ctggggccag       360
     ttctccatgc cgaactcgtt ctggcccgcc cggaagatga acggcttcgt caccggcgac       420
     ctcggtctgg gccacatcgt gatgatcgtc cccgacctcc aggccgcgga cgcgttctac       480
     gccgagacgc tgggcttccg gctctccgac cgcgtggtca gcgacatctt caacctgcgc       540
     ttctaccact gcaacggccg gcaccactcg ctcgccgtcg ccgagatccc gggcatgacc       600
     ggcatcaacc acctgatgct cgaggtcgag aacatggacg acctcggctc cgcgatcgac       660
     ctgttcaccg cggaccagga gcgcgagatc ctgctctccc tcggccggca caccaacgac       720
     ctgatgacct cgatctacgt gcagaccccg tcgagcatgc agatcgagta cggcttcggc       780
     ggcatcgccg tcgacgacct cacctgggtc gccggtaccc acgacgtgcc gagcatctgg       840
     ggccaccacc gctcgcaggc ctacctcgac ggccctcccg gaatcttcca gatgctcgac       900
     gcggaggccc cggcgtga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page