(data stored in ACNUC1104 zone)

EMBL: CP000509.PE205

CP000509.PE205       Location/Qualifiers
FT   CDS_pept        225787..226626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0210"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ttj:TTHB237
FT                   2-hydroxymuconic semialdehyde hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79755"
FT                   /db_xref="GOA:A1SD70"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD70"
FT                   /protein_id="ABL79755.1"
FT                   /translation="MIRTRDVEVGDLSFRLYETGETGAEAVLFLHGSGPGATGLSNWER
FT                   IIEDLGDRFHCLAPDMIGFGDSAHPVDPPRGMGPFNELRAQALLGLLDVLGLEKVHLVG
FT                   NSMGGQLALLMVLAQPDRVGKILLMGSGGAPDLPVSPGLAHLRTFYDAPSAESLERLLE
FT                   QFVFDLEPMRPVIDRVVKERMAYVERADVRRSHAASFDPDGPRRFFTPEELAGIEHDVL
FT                   VVHGRDDRIIPTQASRWFADHLPNANLYVIGRCGHWTQIEHPTTFETLLTGLVDGVI"
     gtgatccgca cccgcgacgt cgaggtcggc gacctgtcct tccggctcta cgagaccggc        60
     gagaccgggg ccgaggccgt gctgttcctg cacggctcgg gccccggcgc caccggcctg       120
     tcgaactggg aacggatcat cgaggacctc ggcgaccggt tccactgcct ggcacccgac       180
     atgatcgggt tcggcgactc cgcgcacccg gtcgacccgc cgcgtgggat gggtcccttc       240
     aacgagctgc gcgcccaggc gctgctgggc ctgctcgacg tgctcggcct ggagaaggtg       300
     cacctggtcg gcaactcgat gggcggccag ctcgcgctgc tcatggtgct cgcccagccc       360
     gaccgggtcg gcaagatcct gctgatgggc agcggcggcg ccccggacct gcccgtctcc       420
     ccgggcctgg cccacctgcg cacgttctac gacgcgcctt cggcggagag tctcgagcgg       480
     ctgctcgagc agttcgtctt cgacctcgag ccgatgcgtc cggtgatcga ccgggtggtc       540
     aaggagcgga tggcgtacgt cgagcgcgcc gacgtgcgcc gctcgcacgc cgccagcttc       600
     gaccccgacg ggccgcggcg tttcttcacc cccgaggagc tggccggcat cgagcacgac       660
     gtcctcgtcg tgcacggccg cgacgaccgg atcatcccga cccaggcgag ccggtggttc       720
     gccgaccacc tgccgaacgc gaacctctac gtgatcggcc ggtgcgggca ctggacccag       780
     atcgagcacc cgacgacgtt cgagacgctg ttgaccggtc tcgtcgacgg cgtgatctag       840
//

If you have problems or comments...

PBIL Back to PBIL home page