(data stored in ACNUC1104 zone)

EMBL: CP000509.PE206

CP000509.PE206       Location/Qualifiers
FT   CDS_pept        226637..227491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0211"
FT                   /product="5-oxopent-3-ene-1,2,5-tricarboxylate
FT                   decarboxylase"
FT                   /EC_number="4.1.1.68"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rha:RHA1_ro04906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79756"
FT                   /db_xref="GOA:A1SD71"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD71"
FT                   /protein_id="ABL79756.1"
FT                   /translation="MRIANHDGRAVLVLGEDKGVDIERASHGELGPSIADLYPRWDEVV
FT                   AWVSTLGDVGDLVADVVIDPDLLGAPSPRPTQAIAIGLNYEEHAHETGYQVPTQLPPVF
FT                   AKFASSITGPRGLVDLPPGGHTDWEVEVVAVIGRTAHRISPDEAWGHVAGLTVGQDLSE
FT                   RISQMAGPAPQFGLAKSFPGFSPMGPWLVTPEELADPDDLALGCAIDGETVQDGRTSKL
FT                   IFSIPRSIAALSQVLTLLPGDVVFTGTPDGVGLGRSPQRFLRPGETLRTWVEGIGEMVH
FT                   TFR"
     atgcggatcg ccaaccacga cggacgcgcc gtactcgtgc tgggcgagga caagggcgtc        60
     gacatcgagc gcgccagcca cggcgagctc ggcccctcga tcgccgacct ctacccgcgc       120
     tgggacgagg tcgtggcgtg ggtgtccacg ctcggcgacg tcggcgacct ggtggccgac       180
     gtcgtcatcg accccgacct gctgggcgcg ccgtcgccgc ggcccacgca ggcgatcgcg       240
     atcgggctca actacgagga gcacgcccac gagaccggct accaggtgcc gacccagctg       300
     ccgccggtgt tcgcgaagtt cgccagcagc atcaccgggc cgcgcggcct cgtcgacctg       360
     ccgcccggcg gccacaccga ctgggaggtg gaggtcgtcg cggtcatcgg ccgcacggcg       420
     caccgcatct cgcccgacga ggcctggggc cacgtcgccg gcctcaccgt cggccaggac       480
     ctctcggagc ggatctccca gatggccggt ccggctcctc agttcggcct ggccaagtcg       540
     ttccccggct tcagcccgat ggggccgtgg ctggtcaccc ccgaggagct cgccgatccc       600
     gacgacctgg cgctgggctg tgcgatcgac ggcgagaccg tccaggacgg gcgcaccagc       660
     aagctgatct tctcgatccc gcgcagcatc gccgccctgt cgcaggtgct caccctgctg       720
     cccggcgacg tggtcttcac cggcaccccc gacggcgtcg ggctcggccg ctccccgcag       780
     cgcttcctcc gccccggcga gacgctgcgc acctgggtcg aggggatcgg cgagatggtg       840
     cacaccttcc gctga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page