(data stored in ACNUC1104 zone)

EMBL: CP000509.PE207

CP000509.PE207       Location/Qualifiers
FT   CDS_pept        complement(227624..227929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79757"
FT                   /db_xref="GOA:A1SD72"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD72"
FT                   /protein_id="ABL79757.1"
FT                   /translation="MDTRSADLDTVSTRAGTATLGLGLLFLAATIFIFVLSLSDLVDPP
FT                   TWVRVLGLVWLPLGFFGAPLTYAVARAGPGRNRGRLGLALMLVPLAAFVALLFVAG"
     atggacacgc gatcagccga cctggacacg gtctccacgc gcgccgggac cgcgaccctc        60
     ggcctcggcc tgctcttcct cgccgccacg atcttcatct tcgtgctgag cctcagcgac       120
     ctcgtcgacc cgcccacctg ggtgcgggtc ctcggcctgg tctggctgcc gctcgggttc       180
     ttcggcgcgc cgctgaccta cgcggtcgcc cgcgccgggc ccgggcgcaa ccgcgggcgt       240
     ctcggcctcg cgctgatgct cgtccccctg gccgcattcg tagcgctgct gttcgttgcc       300
     ggctga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page