(data stored in ACNUC1104 zone)

EMBL: CP000509.PE210

CP000509.PE210       Location/Qualifiers
FT   CDS_pept        complement(231042..231788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0215"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sme:SMc02358 putative high-affinity branched-chain
FT                   amino acid transport ATP-binding ABC transporter protein;
FT                   TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79760"
FT                   /db_xref="GOA:A1SD75"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD75"
FT                   /protein_id="ABL79760.1"
FT                   /translation="MTDHQAGDVRTIAEPPLLRVRDLAAAYGPKQVLYGVDLEVRAGEI
FT                   VALMGHNGAGKTTTIRTVLGALRARSGEVSVAGEDLTGQPVRRLVRAGVALVPSERFVF
FT                   PDLSIRDNLLLGAANAPRDADSAARLREVEEAFPLLSERSSQLAGQLSGGQQRMVSLGI
FT                   ALMAQPRLLLLDEPSLGLAPSIVEAIFGRLRALATSSGLGILLLEQNVKQALQIADRAY
FT                   VMRSGRVILEEPAAQMRRRPDFWDLF"
     gtgaccgatc accaggccgg cgacgtgcgg acgatcgccg agccgccgct gctgcgggtg        60
     cgcgacctgg cggcggcgta cggccccaag caggtgctgt acggcgtcga cctggaggtc       120
     cgtgccggcg agatcgtggc gctgatgggc cacaacggcg cgggcaagac cacgaccatc       180
     cgcaccgtgc tcggcgcgct gcgggcccgc tcgggcgagg tctcggtcgc cggggaggac       240
     ttgaccgggc agccggtccg ccgtctggtc cgcgccggtg tcgcgctggt cccctcggag       300
     cgcttcgtgt tccccgacct ctcgatccgc gacaacctgc tgctcggtgc ggccaacgca       360
     ccccgggacg ccgactccgc cgcgcggctg cgcgaggtcg aggaggcgtt cccgctcctg       420
     tccgagcgca gctcgcagct ggccggccag ctctccggcg gccagcagcg gatggtcagc       480
     ctcggcatcg cgctgatggc ccagccccgg ctgctgctgc tcgacgagcc ctcgctcggc       540
     ctcgcgccgt cgatcgtgga ggcgatcttc ggccggctgc gcgcgctggc cacgtcgtcg       600
     ggactcggca tcctgctgct ggagcagaac gtcaagcagg cgctgcagat cgcggaccgc       660
     gcctacgtga tgcgctcggg ccgggtgatc ctcgaggagc ccgccgccca gatgcggcgg       720
     cgtccggact tctgggacct gttctga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page