(data stored in ACNUC1104 zone)

EMBL: CP000509.PE212

CP000509.PE212       Location/Qualifiers
FT   CDS_pept        complement(233538..234467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0217"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: gka:GK2979
FT                   branched-chain amino acid ABC transporter (permease); TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79762"
FT                   /db_xref="GOA:A1SD77"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD77"
FT                   /protein_id="ABL79762.1"
FT                   /translation="MDSLISADFWQLTANGLVRGSFYAALGAGLALVLGVTARFHFAYT
FT                   LTYTFAPYAAFLAMDRQGVSFWPAALLGLAAAVVLSVLIELLVYQPVARRAGDRAMLAV
FT                   LVTSIGVSAAGIAALQLVAGTSSVPFYGPAMTISEYGPVRVSSFELYQVLTCVGLVVAL
FT                   AAFLALTPLGRSIRAVRSNPGLAGLLGIGVTRVNLTVFAIAGLFSGAGALWYGLLYTVE
FT                   PVMGDKVVIYGFVVAFLAGTRTSPLRALPVGLGLGLLEQWSSMWVSVQWTQTAVFTVLV
FT                   VYLVALSGRGRWGRLLSPRPRARLEKAV"
     atggacagcc tgatcagcgc cgacttctgg cagctcaccg cgaacggcct ggtccgcggg        60
     tcgttctacg cggccctcgg cgccgggctg gcgctggtgc tgggcgtgac ggcgcgcttc       120
     cacttcgcct acacgctcac ctacacgttc gctccgtacg ccgcgttcct ggcgatggac       180
     cgccagggcg tgtcgttctg gccggcggcg ctgctcggac tcgccgccgc cgtggtgctc       240
     agcgtgctga tcgagctgct ggtctaccag ccggtcgccc ggcgtgccgg ggaccgcgcg       300
     atgctcgccg tcctggtcac ctcgatcggc gtcagcgccg ccggcatcgc cgccctgcag       360
     ctggtcgccg gcaccagcag cgtgccgttc tacggccccg cgatgacgat ctcggagtac       420
     ggcccggtgc gggtctcgag cttcgagctc taccaggtcc tcacctgcgt cggcctggtc       480
     gtcgcgctcg cggcgttcct cgcgctcacc ccgctcggcc gctcgatccg cgcggtccgg       540
     agcaacccgg ggctcgccgg cctcctcggc atcggcgtca cccgggtgaa cctcaccgtc       600
     ttcgcgatcg ccgggctgtt ctccggcgcc ggcgcgctct ggtacggcct gctgtacacc       660
     gtcgagccgg tgatgggcga caaggtcgtg atctacggct tcgtggtcgc cttcctcgcc       720
     ggcacccgca ccagcccgct gcgcgcgctc cccgtgggac tcggcctcgg gctgctcgag       780
     cagtggtcgt cgatgtgggt ctcggtgcag tggacccaga cggcggtgtt caccgtgctc       840
     gtcgtctacc tggtggccct gtccggtcgc ggccgttggg gtcggctgct gtccccccgg       900
     ccccgcgccc ggctcgagaa ggcggtctga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page