(data stored in SCRATCH zone)

EMBL: CP000509.PE213

CP000509.PE213       Location/Qualifiers
FT   CDS_pept        complement(234534..235880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0218"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="KEGG: nfa:nfa52540 hypothetical protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79763"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD78"
FT                   /protein_id="ABL79763.1"
FT                   /translation="MSVLPSTRRGPRARSTSRSVRRSVALGAALALALSLSACGEDKPE
FT                   VSAAETQAQAADLVDLLAIPEGTDLGGDLTWKMGAALTLSGPSAANGESMKNAIDLAVE
FT                   QVKAAGGPTIEVLTKDIKGPDPVAAKQAAEELAAAGVPAKITSMGDGLGAMLENTAKDQ
FT                   ILSLDGVGGAQVFTQGVDYFFGTREVAPSDAVPGALEWLKQSDPEATTVGLVGVDLGPF
FT                   NDPIKADITAKIDASGLQFNGLWETVAPTSQDYASVISKIKENQPDMLLVAFGGGAPGA
FT                   FAAQAKAAGLDSLLMGIEFTEEAVKASKGVLDSDGFHFAMDYFDAENPANPLAELFVDS
FT                   YEKAYGVKPDFYAANAYEEVLMFWDLVRRVVADGGDPNDSAALKAALEADPTFASVYGA
FT                   GEGDGPGTLAIDLKTHGVASRPMGVYEYQDGAVSTLATFDVNAAGFALN"
     atgtcggtcc ttcccagcac ccggcgcggc ccccgcgccc gatccaccag caggtccgta        60
     cgccggtccg tcgcgctcgg cgcggccctc gcgctggccc tgagcctgtc ggcctgcggc       120
     gaggacaagc ccgaggtcag cgccgccgag acccaggccc aggcggccga cctggtcgac       180
     ctgctcgcca tccccgaggg caccgacctc ggcggcgacc tcacctggaa gatgggcgcg       240
     gcgctcaccc tgtccggccc ctcggcggcc aacggcgagt cgatgaagaa cgcgatcgac       300
     ctggccgtcg agcaggtcaa ggccgccggc ggcccgacca tcgaggtcct caccaaggac       360
     atcaagggtc ccgacccggt cgccgccaag caggccgccg aggagctcgc cgccgcgggc       420
     gtgcccgcca agatcacctc gatgggtgac ggcctcggcg cgatgctgga gaacaccgcg       480
     aaggaccaga tcctcagcct cgacggcgtc ggcggcgccc aggtcttcac ccagggcgtg       540
     gactacttct tcggcacccg cgaggtcgcc ccgtccgacg ccgtccccgg cgcgctcgag       600
     tggctcaagc agagcgaccc cgaggcgacg accgtcggcc tggtgggcgt cgacctgggc       660
     ccgttcaacg acccgatcaa ggccgacatc accgcgaaga tcgacgcctc cggcctgcag       720
     ttcaacgggt tgtgggagac cgtcgccccg acgtcgcagg actacgcgag cgtgatcagc       780
     aagatcaagg agaaccagcc cgacatgctg ctcgtcgcct tcggtggcgg agcgccgggt       840
     gcgttcgccg cccaggccaa ggccgccggg ctcgactcac tgctgatggg catcgagttc       900
     accgaggagg cggtcaaggc ctccaagggc gtgctggact ccgacggctt ccacttcgcc       960
     atggactact tcgacgccga gaacccggcc aacccgctcg ccgagctgtt cgtcgactcc      1020
     tacgagaagg cgtacggcgt gaagccggac ttctacgcgg ccaacgccta cgaggaggtc      1080
     ctgatgttct gggacctggt gcgccgcgtg gtcgccgacg gcggtgaccc gaacgacagc      1140
     gccgcgctca aggccgcgct cgaggccgac ccgaccttcg cgtccgtcta cggagccggc      1200
     gagggcgacg gcccgggaac cctcgcgatc gacctgaaga cgcacggcgt cgccagccgg      1260
     ccgatgggtg tctacgagta ccaggacggt gcggtctcca cgctcgcgac cttcgacgtc      1320
     aacgccgccg gcttcgccct gaactga                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page