(data stored in ACNUC1104 zone)

EMBL: CP000509.PE214

CP000509.PE214       Location/Qualifiers
FT   CDS_pept        236113..236748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0219"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP1732c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79764"
FT                   /db_xref="GOA:A1SD79"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD79"
FT                   /protein_id="ABL79764.1"
FT                   /translation="MPRKTTRRHRQGDESRHRILATTLEIAAERGYEGTTVGLVTERTG
FT                   LPASSVYWHFKNKDELLAETLEYSYRQWREATPTWEGVDDEGVPDLRAEVRRRLRAASR
FT                   ALLESPEFWRLGLMLALERRAKEPAARGRYVEVRLETAAAIARWWASVLPAELRERDDE
FT                   LPDRLARVHLALMDGFFVGRRADPRWDVGAMVELMAEGMAAYVEGVAR"
     atgccgagga agaccacgcg ccgccatcgc cagggtgacg agtcgcggca ccggatcctc        60
     gcgaccaccc tggagatcgc agccgagcgc ggctacgagg gcaccacggt cgggctggtg       120
     accgagcgga ccggcctgcc ggccagctcg gtctactggc acttcaagaa caaggacgag       180
     ctgctcgccg agaccctcga gtactcctac cgccagtggc gcgaggcgac ccccacgtgg       240
     gagggcgtcg acgacgaggg cgtgccggac ctgcgcgcgg aggtgcgccg gcggctgcgc       300
     gcggcgagcc gcgcgctgct ggagtccccc gagttctggc ggctcggcct gatgctcgcc       360
     ctcgagcggc gggccaagga gccggccgct cgcggccggt acgtcgaggt gcggctcgag       420
     accgccgccg cgatcgcccg ctggtgggcg tcggtgctgc ccgccgagct gcgcgagcgc       480
     gacgacgagc tgcccgaccg gctcgcccgc gtccacctcg ccctgatgga cgggttcttc       540
     gtggggcggc gggccgaccc gcgctgggac gtcggggcga tggtcgagct gatggccgag       600
     ggcatggcgg cgtacgtcga gggggtcgcg cgatga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page