(data stored in SCRATCH zone)

EMBL: CP000509.PE216

CP000509.PE216       Location/Qualifiers
FT   CDS_pept        237463..238644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0221"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: nar:Saro_1462 flavin reductase-like, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79766"
FT                   /db_xref="GOA:A1SD81"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD81"
FT                   /protein_id="ABL79766.1"
FT                   /translation="MSDPNPAHFRQVLGQYPTGVAVVTALDESGAPLGMTVGSFTSVSL
FT                   DPPLVAFLPDQGSSSWRALRASGDRFCVNVLGADQEDVCRAIAVRKVDKFAGIPWRPSP
FT                   AGNPVIDGAVAYLDCTTEQVHDAGDHHIVVGRVHQLDLVGGDQPLLFFRGGYGSFTPLS
FT                   LASGDSDLLDHLRLVDLARPQMDRLAARFDTEVTAIALVRDELVLAAAAGRTRLAVAPT
FT                   RVGQRLPFMPPLGSCFAGWGDDAVRAAWVGGLSDLVDPDTRDAVRAVPGLVRRRGYSIA
FT                   LGHGDGARLETLSTRFHEGDAQVSKAALREAIAQSVSGYNPASYGAGPVELRSLSAPVF
FT                   ANDGRVAFTLTLWGPPGAIDAAEVDRHVEELLAATGAATIAIDGRVPLDAAIA"
     atgagcgacc cgaacccggc ccacttccgg caggtgctgg gccagtaccc caccggtgtc        60
     gcggtggtga ccgcgctcga cgagtccggt gccccgctcg ggatgacggt cggctccttc       120
     acctcggtct cgctcgaccc gccgctcgtg gcgttcctgc ccgaccaggg gtccagctcg       180
     tggcgcgcgc tgcgcgcctc cggcgaccgg ttctgcgtca acgtcctcgg cgccgaccag       240
     gaggacgtgt gccgcgcgat cgcggtccgc aaggtcgaca agttcgcggg catcccgtgg       300
     cggccgtcgc cggccggcaa cccggtgatc gacggcgcgg tcgcgtacct cgactgcacg       360
     accgagcagg tccacgacgc cggcgaccac cacatcgtcg tcggtcgggt gcaccagctc       420
     gacctggtcg gcggcgacca gccgttgctg ttcttccgcg gcggttatgg ctcgttcacc       480
     ccgctctcgc tggcctcggg cgacagcgac ctgctcgacc acctgcgcct cgtcgacctg       540
     gcccggccgc agatggaccg gctcgcggcc cgcttcgaca ccgaggtcac cgcgatcgcg       600
     ctggtgcgcg acgagctggt gctggcggcc gcggccggcc gcacccggct cgccgtcgcg       660
     ccgacccggg tggggcagcg gttgccgttc atgccgccgc tgggcagctg cttcgccggt       720
     tggggcgacg acgcggtccg cgccgcgtgg gtgggcggcc tctcggacct ggtcgacccc       780
     gacacccggg acgccgtacg cgcggtgccc ggactggtgc gtcgccgcgg ctactcgatc       840
     gcactcggcc acggcgacgg tgcccgcctc gagacgctga gcacccgctt ccacgagggc       900
     gacgcccagg tctccaaggc cgccctgcgc gaggcgatcg cgcagagcgt ctccggctac       960
     aaccccgcgt cgtacggcgc cgggccggtc gagctccgct cgctgagcgc accggtgttc      1020
     gccaacgacg gccgggtcgc gttcaccctc acgctctggg ggccgcccgg cgccatcgac      1080
     gccgccgagg tcgaccgcca cgtcgaggag ctgctcgccg cgaccggcgc cgcgacgatc      1140
     gccatcgacg gccgggtccc cctcgacgcc gccatcgcct ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page