(data stored in ACNUC1104 zone)

EMBL: CP000509.PE218

CP000509.PE218       Location/Qualifiers
FT   CDS_pept        239725..240201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0223"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: rha:RHA1_ro05231 possible carbon monoxide
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79768"
FT                   /db_xref="GOA:A1SD83"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD83"
FT                   /protein_id="ABL79768.1"
FT                   /translation="MEVTLTVNGEVVTRDVEARLLLVHFLRDDLGLTGTHWGCDTSNCG
FT                   SCVVLYDDEPVKSCTVLTAMAAGHDVRTVEDLEQDGELDPVQQGFMECHGLQCGFCTSG
FT                   MLMSARALLDRDPDPSEEDIREAISGQICRCTGYASIVRSVRWAADHPEGRIEA"
     gtggaggtga ccctcacggt gaacggcgag gtcgtcaccc gcgacgtgga ggcgcgcctg        60
     ctgctcgtgc acttcctgcg cgacgacctc ggcctgaccg gtacgcactg gggctgcgac       120
     accagtaact gcggcagctg cgtggtcctg tacgacgacg agccggtcaa gtcgtgcacc       180
     gtgctcaccg cgatggccgc cggtcatgac gtccgcaccg tcgaggacct cgagcaggac       240
     ggggagctcg acccggtgca gcagggcttc atggagtgcc acggcctcca gtgcggcttc       300
     tgcacctccg ggatgctgat gtccgcccgg gcgctgctcg accgcgaccc ggacccgagc       360
     gaggaggaca tccgggaggc gatctcggga cagatctgcc ggtgcaccgg ctacgcctcg       420
     atcgtccgct ccgtgcgctg ggccgccgac caccccgagg ggaggatcga ggcatga          477
//

If you have problems or comments...

PBIL Back to PBIL home page