(data stored in ACNUC1104 zone)

EMBL: CP000509.PE22

CP000509.PE22        Location/Qualifiers
FT   CDS_pept        complement(23664..25457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0022"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; PASTA domain containing
FT                   protein; SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; KEGG: tfu:Tfu_3066 tyrosine protein
FT                   kinase:serine/threonine protein kinase:PASTA"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79572"
FT                   /db_xref="GOA:A1SCN7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN7"
FT                   /protein_id="ABL79572.1"
FT                   /translation="MSNHQPTVGGRYQLGELLGRGGMAEVRKGTDTRLGRVVAVKRLRT
FT                   DLASDATFQARFRREAQSAASLNHPSIVAVYDTGEEPAADGSGISQPYIVMEFVAGRTL
FT                   RDILREGRKILPERALEITSGVLSALDYSHRAGIIHRDIKPGNVMLTPSGDVKVMDFGI
FT                   ARAISDASSTMTQTAAVVGTAQYLSPEQARGETVDSRSDVYSAGCLLYELLTGRPPFVG
FT                   DSPVAVAYQHVREPAVPPSDHDTELPPEIDAIVMKALAKRVEDRYQSAAAMRSDIERYL
FT                   AGRPVQAPIPAPVPPPPSATDRTAVVGAVPAADDEPPRSRTGLLVLIGALLVALLLAGA
FT                   YFVWPRLFEQAPEQVAVPNVVGKNETQARRLIGEAELAVGTIDRENSDTVKAGNVIRQS
FT                   PEPDRYVDPDTAVDFVISLGVPEVNVPPVVGLDKDAARAQLEAADFVVRTEEKESDEPA
FT                   GEVIETNPPANASVEQGSTVVVFYSDGPEEVPDVRGLMQPQAKNKIRAAGFEPRVIADP
FT                   DSTEPAGTVTDQSPEPGETPSQGSTVTILVSTYEEPTESPTPSESPTDNPTEPPPPVLD
FT                   RSAVSPRSVSSRRWGRAAPRS"
     atgagcaacc accagcccac cgtcggtggc cgctaccagc tcggtgagct gctcggccgc        60
     ggcggcatgg ccgaggtccg caagggcacc gacacccggc tcggccgggt ggtcgcggtc       120
     aagcggctgc gcaccgacct ggcgagcgac gcgaccttcc aggcccggtt ccggcgcgag       180
     gcgcagtcgg ccgcgtcgct gaaccacccg tcgatcgtcg ccgtctacga caccggtgag       240
     gagccggccg ccgacgggtc cgggatctcc cagccctaca tcgtgatgga gttcgtcgcc       300
     ggccggaccc tgcgcgacat cctgcgcgag ggccgcaaga tcctcccgga gcgcgcgctg       360
     gagatcacca gcggcgtgct ctcggcactc gactacagcc accgggcggg catcatccac       420
     cgcgacatca agcccggcaa cgtgatgctc acgccgagcg gcgacgtgaa ggtgatggac       480
     ttcggcatcg cccgcgcgat cagcgacgcg tcctcgacga tgacccagac cgcggcggtc       540
     gtcggcactg cgcagtacct ttccccggag caggcgcgcg gcgagaccgt cgactcgcgc       600
     tcggacgtct actccgccgg ctgcctgctc tacgagctgc tcaccggccg cccgccgttc       660
     gtcggcgaca gcccggtcgc ggtcgcctac cagcacgtcc gcgagcccgc cgtcccgccg       720
     tccgaccacg acaccgagct gccgcccgag atcgacgcga tcgtgatgaa ggcgctggcc       780
     aaacgcgtcg aggaccgcta ccagtcagca gccgcgatgc gcagcgacat cgagcgctac       840
     ctcgccggcc ggccggtgca ggcgccgatt ccggcgccgg tgccgccgcc cccgtcggcc       900
     accgaccgga ccgccgtcgt cggggcggtg ccggccgccg atgacgaacc cccgcgcagc       960
     cgcaccggcc tgctggtcct catcggggcg ctgctcgtgg cgctgctcct ggccggcgcg      1020
     tacttcgtgt ggccgcggct cttcgagcag gccccggagc aggtggcggt gccgaacgtg      1080
     gtcgggaaga acgagaccca ggcacgccgg ctgatcggcg aggcggagct cgcggtcggg      1140
     accatcgacc gcgagaacag cgacacggtc aaggccggga acgtgatccg gcagagcccg      1200
     gagccggatc ggtacgtcga tccggacacc gccgtcgact tcgtcatctc gctcggtgtg      1260
     cccgaggtga acgtcccgcc ggtggtcggc ctcgacaagg acgccgcccg ggcgcagctg      1320
     gaggccgccg acttcgtcgt gaggaccgag gagaaggagt ccgacgagcc ggccggcgag      1380
     gtgatcgaga cgaacccgcc ggccaacgcc tcggtcgagc agggcagcac cgtggtggtc      1440
     ttctactccg acggtcccga ggaggtgccc gacgtccgcg ggctgatgca gccgcaggcg      1500
     aagaacaaga tccgggccgc cggcttcgag ccgcgcgtga tcgcggaccc ggactccacc      1560
     gagccggccg ggacggtgac cgaccagagc ccggagcccg gtgagacacc gtcccagggc      1620
     tcgacggtga ccatcctcgt ctcgacctac gaggagccga ccgagtcgcc gacgccgagc      1680
     gagtcgccga ccgacaaccc gacggagccc ccgccgccgg tgctcgaccg gagcgccgtg      1740
     tcgccgcgct cggtcagctc ccggagatgg ggacgagcgg ctccgcgtag ttga            1794
//

If you have problems or comments...

PBIL Back to PBIL home page