(data stored in ACNUC1104 zone)

EMBL: CP000509.PE222

CP000509.PE222       Location/Qualifiers
FT   CDS_pept        244209..244517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79772"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD87"
FT                   /protein_id="ABL79772.1"
FT                   /translation="MTPPLTSRRRSVPVESDGHSRGNPRMYELIENAPRSTSEGPGKSP
FT                   TVWAFPEFVEFLKVAGQPVQGPWPPHQHPRPDPTDVESLPVAIPDPAAEPRHRTEGA"
     gtgacgccac cactcacctc caggaggcgg tccgtgccgg tcgagtccga tggtcacagc        60
     cggggcaacc cccggatgta cgagctcatc gagaacgcac cacggtccac atcagagggg       120
     ccgggcaaga gccccaccgt gtgggccttc cccgagttcg tcgagttcct caaggtcgcc       180
     ggccagccgg tgcaggggcc gtggccgccg caccagcacc cgcgcccgga tcccacggac       240
     gtcgagtcgc tgccggtcgc gatcccggac ccggcggcgg agccgcgaca ccggaccgaa       300
     ggagcctga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page