(data stored in ACNUC1104 zone)

EMBL: CP000509.PE223

CP000509.PE223       Location/Qualifiers
FT   CDS_pept        244517..245392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0228"
FT                   /product="molybdopterin dehydrogenase, FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   mmc:Mmcs_0489 carbon-monoxide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79773"
FT                   /db_xref="GOA:A1SD88"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD88"
FT                   /protein_id="ABL79773.1"
FT                   /translation="MYPSRFRYEAPRSIDEAIQLLHEGAGEAKVLAGGQSLVPLMKLRF
FT                   AAPELLVDINNLPGLDHLDVAADGGIRVGALCRHRDLERSLEVARAQPVMAAAAPLIAD
FT                   PIVRTRGTLVGSLCHADPQGDWAAVVTALGGHVVAQGPGGRRSIPITDFVTGPFQNVLE
FT                   YDEVAVEAVLPAPRARVAGGFLKLERRVGDFATAGTAVALELDGDRVTRAGIALTGVGS
FT                   RTVDARAAAEALVGQPLTAEAIGRAADLAAEVAQPTSDHRGSASYKRHVIHTFVTRILT
FT                   RVTQTSEAAA"
     atgtacccgt cccggttccg ctacgaggcg ccgcgctcga tcgacgaggc gatccagctc        60
     ctccacgagg gcgccggcga ggccaaggtc ctcgccggag gccagagcct ggtcccgctg       120
     atgaagctgc ggttcgccgc gcccgagctc ctcgtcgaca tcaacaacct gcccggcctc       180
     gaccacctgg acgtcgcggc cgacggcggc atccgggtcg gcgcgctgtg ccgccaccgt       240
     gacctggagc gctcgctcga ggtcgcgcgg gcgcagccgg tgatggccgc ggccgccccg       300
     ctgatcgccg acccgatcgt ccgcacccgc ggcaccctgg tcggctcgct gtgccacgcg       360
     gatccccagg gggactgggc cgccgtcgtc acggcgctcg gcggccacgt cgtcgcccag       420
     ggcccgggcg gccggcggag catcccgatc accgacttcg tgaccgggcc gttccagaac       480
     gtcctcgagt acgacgaggt cgcggtcgag gcggtcctcc cggcgccacg tgcccgggtg       540
     gccggcggct tcctcaagct cgagcgccgg gtcggcgact tcgccacggc gggcaccgcg       600
     gtcgcgctcg agctcgatgg cgaccgggtc acccgtgccg gcatcgccct cacgggcgtc       660
     ggcagccgca ccgtcgacgc ccgagcggcc gcggaggcgc tcgtcggcca gccgctcacg       720
     gccgaggcga tcggccgtgc ggccgacctc gcggccgagg tggcgcagcc gacctccgac       780
     caccgtggca gcgcgtcgta caagcggcac gtgatccaca ccttcgtcac ccggatcctg       840
     acccgggtca cccagaccag cgaggctgca gcatga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page