(data stored in ACNUC1104 zone)

EMBL: CP000509.PE224

CP000509.PE224       Location/Qualifiers
FT   CDS_pept        245389..245934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0229"
FT                   /product="carbon monoxide dehydrogenase, small subunit"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: rxy:Rxyl_0111 (2Fe-2S)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79774"
FT                   /db_xref="GOA:A1SD89"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD89"
FT                   /protein_id="ABL79774.1"
FT                   /translation="MTSLFEEVPAAAAEGVPVRRITVRVNGTPRTADVEPRLLLAHLLR
FT                   QGFKLTGTHTGCDTTNCGACTVLVDGLPVKSCTMLAVQADGHEVTTVEGLAGPSELHPL
FT                   QEGFKDEHGLQCGFCTPGMMLAAKALLAENPDPTEDEVRFALSGNLCRCTGYQNIVKSV
FT                   LWAAKQMNGASADEGSAE"
     atgacgagct tgttcgaaga agttcccgcg gccgcggccg aaggcgtccc ggtccgtcgg        60
     atcaccgtcc gcgtcaacgg cacgccgagg accgccgacg tcgagccacg gctgctgctc       120
     gcccacctgc tgcgccaggg cttcaagctc accggcaccc acaccggctg cgacaccacg       180
     aactgcggcg cctgcaccgt gctggtcgac gggctgccgg tcaagagctg cacgatgctc       240
     gccgtccagg cggacggcca cgaggtgacc acggtcgagg gactggccgg accgagcgag       300
     ctgcacccgc tgcaggaggg cttcaaggac gagcacggcc tgcagtgcgg gttctgcacc       360
     ccgggcatga tgctcgccgc caaggcgctg ctcgccgaga acccggaccc gaccgaggac       420
     gaggtgcggt tcgcgctgtc cggcaacctg tgccgctgca ccggctacca gaacatcgtg       480
     aagtcggtgc tgtgggcggc caagcagatg aacggcgcct cggctgacga ggggagcgcg       540
     gagtga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page