(data stored in ACNUC1104 zone)

EMBL: CP000509.PE23

CP000509.PE23        Location/Qualifiers
FT   CDS_pept        complement(25454..26899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0023"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein of unknown function RIO1; protein
FT                   kinase; SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; KEGG: tfu:Tfu_3065 tyrosine protein
FT                   kinase:serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79573"
FT                   /db_xref="GOA:A1SCN8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN8"
FT                   /protein_id="ABL79573.1"
FT                   /translation="MTSTPDQGHGFADAEHRYRLDSRIATGGMGEVWRGTDTTLGRQVA
FT                   VKLLKNEYADNPSFRTRFETEAQHAASLHHPNIAAVYDFGEAPAADGSGVQRPFLVMEL
FT                   VDGQPLSALLRPGAPMDPDAVRELLAQAADGLAAAHAAGIVHRDVKPANLLVTPDRQVK
FT                   ITDFGIARAAEGIGLTGTGEVMGTPQYLSPEQAQGQTATPASDVYSLGVVAFECLAGRR
FT                   PFVADTAVATALAHLREPVPPLPESVPADLAAVVRRALAKLPQDRFADGAALAAALRDP
FT                   ATAVTELGPPVEHDHTRVLPGVAGVLPAEPTPLPGPVAGHVPDPPRVRRRNALWPVLAV
FT                   LALVAVAVIVVLLVAEGIGSDGPTDEPTRSPQQSRSTQPTSEPPSSQPTSPLPSSEPTS
FT                   APPSSEPTSAPPSSEPTSATPTPTPTPTATDSGAPVAPSQSATGAAASEPAAPDSSASR
FT                   PVAGPGGPSTSPSTSSQGEVDRR"
     gtgacctcga caccggacca gggccacggc ttcgccgacg ccgagcaccg ctaccgcctc        60
     gactcccgga tcgccaccgg cggcatgggc gaggtctggc gcggcaccga caccacgctg       120
     ggccgtcagg tcgcggtcaa gctgctcaag aacgagtacg ccgacaaccc gtcgttccgc       180
     acccgcttcg agaccgaggc gcagcacgcc gcctcgctgc accaccccaa catcgccgcc       240
     gtctacgact tcggcgaggc ccccgccgcc gacgggtccg gggtgcagcg gccgttcctg       300
     gtgatggagc tcgtcgacgg gcagccgctc tccgcgctgc tgcgacccgg ggcgccgatg       360
     gacccggacg ccgtgcgcga gctgctcgcc caggcggccg acggcctggc cgccgcccac       420
     gcggccggga tcgtgcaccg cgacgtcaag ccggccaacc tgctggtgac gcccgaccgg       480
     caggtcaaga tcaccgactt cgggatcgcg cgcgccgccg aggggatcgg gctgaccggg       540
     accggcgagg tgatgggcac cccgcagtac ctctccccgg agcaggccca gggtcagacg       600
     gcaacgcccg cctcggacgt ctactccctc ggcgtggtcg ccttcgagtg cctcgccggc       660
     cgccggccgt tcgtcgcgga cacggccgtc gccacggcgc tggcccacct gcgcgagccg       720
     gtgcccccgc tgccggagtc ggtcccggcc gacctggccg ccgtcgtacg ccgcgcgctc       780
     gcgaagctgc cccaggaccg gttcgccgac ggcgcggccc tggccgccgc cctgcgcgac       840
     ccggccacgg cggtcaccga gctcggtcct ccggtcgagc acgaccacac ccgggtgctg       900
     cccggcgtgg ccggcgtcct ccctgctgag cccacgccgc tgcccggccc ggtcgccggc       960
     catgtcccgg acccgccgcg ggtgcgccgg cgcaacgccc tgtggccggt gctggcggtg      1020
     ctggccctgg tcgccgtcgc cgtgatcgtc gtcctgctcg tcgcggaggg catcgggtcc      1080
     gacggcccga ccgacgagcc cacccgctcg ccccagcaga gccgcagcac gcagcccacc      1140
     tccgagcccc cgtcgtcgca gcccacgtcg ccgctgccgt cctccgagcc cacgtcggcg      1200
     cctccgtcct ccgagcccac gtcggcgccg ccgtcctccg agcccacctc cgccacgccg      1260
     acaccgacgc ccacgccgac ggccacggac tccggtgcac cggtcgcgcc gtcgcagtcc      1320
     gccaccggcg cggccgcctc cgagccggcc gcccccgact cgtccgccag caggcccgtc      1380
     gccggacccg gcggtccgtc caccagcccg tccacgagca gccaaggcga ggtcgaccgt      1440
     cgatga                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page