(data stored in ACNUC1104 zone)

EMBL: CP000509.PE230

CP000509.PE230       Location/Qualifiers
FT   CDS_pept        250590..250877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79780"
FT                   /db_xref="GOA:A1SD95"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD95"
FT                   /protein_id="ABL79780.1"
FT                   /translation="MTVLLTDTQESLWWGAVIGGFVVVLAVAALLTILVLEVRTIDTRV
FT                   ASVKATLLEAETNTNDTALIATTAAGVDAVLAEGLEHHLFLGRVLGKVRM"
     gtgacagtcc tgttgaccga cacccaggag agcctgtggt ggggcgccgt gatcgggggc        60
     ttcgtcgtcg tcctcgcggt cgcggcgctg ctgacgatcc tggtgctcga ggtgcgcacc       120
     atcgacaccc gggtcgcgtc ggtgaaggcg acgctgctcg aggccgagac gaacacgaac       180
     gacacggcgc tgatcgccac gaccgcagcc ggggtcgacg cggtgctcgc cgaggggctc       240
     gagcaccacc tgttcctcgg ccgggtcctc ggaaaggtgc ggatgtga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page