(data stored in ACNUC1104 zone)

EMBL: CP000509.PE231

CP000509.PE231       Location/Qualifiers
FT   CDS_pept        250874..251236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79781"
FT                   /db_xref="GOA:A1SD96"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD96"
FT                   /protein_id="ABL79781.1"
FT                   /translation="MTTLVVLSVVDIALLIAGLAFYLYVVGTQLMRIAVNLEECAEIVH
FT                   RIEANAQPILGGLEHINRTGGVVAGALPLLYGMAEGIVAGATYQPPTTARPPAAPASGR
FT                   RRSRLHETVGYEPVGG"
     gtgaccacgc tcgtcgttct ctccgtcgtc gacatcgcgc tgctgatcgc cgggctggcg        60
     ttctacctgt acgtcgtcgg cacccagctg atgcggatcg cggtgaacct cgaggagtgc       120
     gcggagatcg tgcaccgcat cgaggcgaac gcccagccga tcctcggcgg cctcgagcac       180
     atcaaccgca ccggcggcgt ggtcgccggc gcgctgccgc tgctctacgg gatggccgag       240
     ggcatcgtcg ccggcgcgac gtaccagccg ccgacgaccg cccgcccgcc cgccgcaccc       300
     gcgtcgggcc gccgccgttc gcggctgcac gagaccgtcg gctacgagcc ggtcgggggc       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page