(data stored in ACNUC1104 zone)

EMBL: CP000509.PE233

CP000509.PE233       Location/Qualifiers
FT   CDS_pept        complement(251737..252864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0238"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="PFAM: VWA containing CoxE family protein; SMART: von
FT                   Willebrand factor, type A; KEGG: rxy:Rxyl_0115 VWA
FT                   containing CoxE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79783"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD98"
FT                   /protein_id="ABL79783.1"
FT                   /translation="MAESAEPDPGHAFVETLVGFARELRAAGLPVGTGDGVTFCAAMEP
FT                   LDPTDLMDLYWGGRATLVTRREQIPTYHETFLRYFLDHPAPKPDEARPFTIQQREEART
FT                   ALQVPETEQHGEERQEEEAILGLMASDVSALKHKAFASCTPEELAALRRIMRTVRLTPP
FT                   RRRSRRTAAASAGTRPDLRRTVREAMRTHGDPARLRWRQRRKRPRPLVLVLDVSGSMAD
FT                   YSRALLQYAHITSRATSKVEVFCFGTRLTRITRELEHRRPDQALDRAARAVVDWEGGTR
FT                   IGGSLDAFVRDFGRRGTGRGGIVVICSDGLDRGDPALLASAMQRLSRLCHRVVWLNPHG
FT                   AEPASLGMAVATPYVDQVLTARSLADLEAFARSLG"
     gtggctgagt cggccgaacc ggacccgggg cacgcgttcg tcgagacgct ggtcggcttc        60
     gctcgcgagc tgcgggcggc cgggctgccg gtgggaaccg gtgacggcgt gacgttctgc       120
     gcggcgatgg agcccctcga cccgaccgac ctgatggacc tctactgggg cggtcgggcg       180
     acgctggtga cccggcgcga gcagatcccg acgtaccacg agacgttcct gcgctacttc       240
     ctcgaccacc ccgccccgaa gcccgacgag gcgcggccgt tcacgatcca gcagcgcgag       300
     gaggcgcgca ccgcgctaca ggtgccggag accgagcagc acggcgagga gcggcaggag       360
     gaggaggcga tcctcgggct gatggcctcg gacgtgtccg cgctcaagca caaggcgttc       420
     gcgtcctgta caccggagga actggccgcg ctgcgccgga tcatgcgcac cgtccggctc       480
     accccgcccc gccgccgctc gcggcggacc gctgccgcat cggccgggac gcgaccggac       540
     ctgcgccgca ccgtccggga ggcgatgcgc acccacggtg accccgcgag gctgcgctgg       600
     cggcagcgac ggaagcggcc gcggccgctg gtgctggtgc tcgacgtgtc cgggtcgatg       660
     gccgactact cgcgggcgct gctgcagtac gcacacatca cctcgcgcgc gaccagcaag       720
     gtcgaggtgt tctgcttcgg cacccggctc acccggatca cccgcgagct cgagcaccga       780
     cggccggatc aggcgctcga ccgcgcggcc cgcgccgtcg tcgactggga gggtggcact       840
     cgcatcggcg gctccctcga cgcgttcgtg cgcgacttcg gccggcgcgg caccggccgc       900
     ggcggcatcg tggtgatctg ctccgacggc ctcgaccggg gcgacccggc gctgctggcg       960
     tcggcgatgc agcggctgtc ccggctctgc caccgggtcg tgtggctcaa cccgcacggc      1020
     gccgagccgg cctcgctcgg catggccgtc gccacgccgt acgtcgacca ggtgctgacc      1080
     gcccgtagcc tggccgacct ggaggcgttc gcccggagcc tggggtga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page