(data stored in SCRATCH zone)

EMBL: CP000509.PE235

CP000509.PE235       Location/Qualifiers
FT   CDS_pept        complement(253754..253996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79785"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDA0"
FT                   /protein_id="ABL79785.1"
FT                   /translation="MAEPNEVLRALWDADEATEAAVELEHAAPAKVCKRTRGMTFDGMA
FT                   EPGTDLNEAWRDLLAREGKLGTGETIRDLVLGRDA"
     atggccgagc cgaatgaggt cctgcgggcg ctctgggacg ccgacgaggc gaccgaggcc        60
     gccgtcgagc tcgagcacgc cgccccggcg aaggtctgca agcgcacccg cggcatgacc       120
     ttcgacggca tggccgagcc cggcaccgac ctgaacgagg cctggcgcga cctgctcgcc       180
     cgcgagggca agctcggcac cggggagacg atccgcgacc tggtgctcgg ccgggacgca       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page