(data stored in ACNUC1104 zone)

EMBL: CP000509.PE236

CP000509.PE236       Location/Qualifiers
FT   CDS_pept        complement(254151..255320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0241"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   tfu:Tfu_0068 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79786"
FT                   /db_xref="GOA:A1SDA1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDA1"
FT                   /protein_id="ABL79786.1"
FT                   /translation="MSASRLLPTDEAVDLIALVRQIAAEELAPRSAEAEATETFPRDVF
FT                   AMLGRTGLLGLPYPEQHGGGGQPYEVYLQVLEEVGAVWASIGVGISVHALSCFGLATAG
FT                   TAAQQAEWLPAMLGGELLGAYCLSEPHAGSDPAAMRTRARRDGDEYVLNGAKAWTTHGG
FT                   HADFYKVMARTGDQRGDISCFLVPADTPGLSADPPEHKMGLTGSATATMRFDDVRIPAE
FT                   RLLGGEGDGLKIALAGLDAGRLGIAAVATGLAQGALDRAVAYAQERETFGRRIIDHQGL
FT                   AFVLADMEAAVQSARATTLHAARLKDAGLPYGREASVAKLVATDNAMRVTTDAVQVLGG
FT                   YGYTRDFPVERYMREAKVMQIFEGTNQIQRMVISRALDRSTAGTLTVAP"
     atgtccgcat cgcgcctgct gcccaccgac gaggccgtcg acctgatcgc actcgtccgc        60
     cagatcgccg ccgaggagct ggcaccacgc tcggccgagg ccgaggccac cgagaccttc       120
     ccgcgcgacg tcttcgcgat gctgggccgg accggcctgc tcggcctccc ctaccccgag       180
     cagcacggtg gcggcggcca gccgtacgag gtctacctgc aggtcctcga ggaggtcggc       240
     gcggtctggg cgagcatcgg cgtcgggatc tccgtgcacg ccctgagctg cttcggcctc       300
     gcgaccgccg gcaccgcggc ccagcaggcc gagtggctgc cggcgatgct cggcggcgag       360
     ctgctcgggg cctattgcct ctccgagccg cacgccggat ccgacccggc cgcgatgcgc       420
     acccgggccc gccgcgacgg cgatgagtac gtcctcaacg gcgcgaaggc ctggaccacc       480
     cacggagggc acgccgactt ctacaaggtg atggcgcgca ccggcgacca gcgcggcgac       540
     atctcctgct tcctggtgcc tgccgacacc ccgggcctgt ccgccgaccc gcccgagcac       600
     aagatggggc tgaccgggtc ggcgaccgcg acgatgcgct tcgacgacgt gcggatcccg       660
     gccgagcggc tcctgggcgg cgagggcgac ggcctcaaga tcgcgctggc cggcctggac       720
     gcgggccggc tcggcatcgc cgccgtcgcg accgggctcg cccaaggtgc cctcgaccgc       780
     gcggtcgcct acgcccagga gcgagagacg ttcggcaggc ggatcatcga ccaccagggc       840
     ctggcgttcg tgctggccga catggaggcg gccgtgcagt ccgcccgcgc cacgaccctc       900
     cacgccgcgc ggctcaagga cgccgggctg ccgtacggcc gcgaggcctc ggtcgccaag       960
     ctggtcgcca ccgacaacgc gatgcgggtg accaccgacg ccgtccaggt gctcgggggc      1020
     tacggctaca cccgggactt cccggtcgag cgctacatgc gcgaggcgaa ggtgatgcag      1080
     atcttcgagg gcaccaacca gatccagcgg atggtgatct cgcgcgccct ggaccgcagc      1140
     accgccggca ccctcaccgt cgcaccgtga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page