(data stored in ACNUC1104 zone)

EMBL: CP000509.PE239

CP000509.PE239       Location/Qualifiers
FT   CDS_pept        256882..257550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79789"
FT                   /db_xref="GOA:A1SDA4"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDA4"
FT                   /protein_id="ABL79789.1"
FT                   /translation="MNLTLATLVGLAGTLLAAGYTVPQFSKLRRMATAAGVSVAALASS
FT                   TISGVAWTVFGVLEHDIWVALPAAVAVPATVGALVLAWLRGGSRERLWLPAAWLATVSL
FT                   AGLATLWVGPTPATVVLGFSVALLVTPAALTAWRSRDVSAIAASAWALMILDALLAGAY
FT                   GLLAGVDANLIYAAVATIGSLAVLLRIAVPAHVHARLVPLPALADAEVEVVPEDLSLVA
FT                   "
     gtgaacctga ccctcgccac cctcgtcggc ctcgccggca ccctcctcgc cgccggctac        60
     accgtcccgc agttcagcaa gctgcgtcgg atggccaccg ccgccggggt gagcgtcgcg       120
     gcgctggcga gctcgacgat cagcggggtc gcctggacgg tcttcggcgt gctcgagcac       180
     gacatctggg tcgcgctgcc cgcagccgtc gccgtaccgg cgaccgtcgg cgcgctggtc       240
     ctcgcctggc tgcgcggcgg gtcgcgcgag cggctgtggc tgcccgcggc gtggctggcg       300
     acggtctccc tggccggtct cgcgacgctc tgggtcgggc ccactcctgc caccgtcgtc       360
     ctcggcttct cggtggccct gctcgtcacg cccgccgcgc tgaccgcgtg gcgcagtcgg       420
     gacgtctccg cgatcgcggc ctccgcgtgg gcgctgatga tcctggacgc gctgctcgcc       480
     ggcgcgtacg gcctcctggc cggtgtcgac gcgaacctga tctacgccgc cgtcgccacg       540
     atcggctcgc tggcggtgct gctgcgcatc gccgtcccgg cgcacgtgca cgcccgcctg       600
     gtcccgctcc ccgccctggc cgacgccgag gtcgaggtcg tgcccgagga cctcagcctg       660
     gtcgcctga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page