(data stored in ACNUC1104 zone)

EMBL: CP000509.PE240

CP000509.PE240       Location/Qualifiers
FT   CDS_pept        complement(257634..258317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0245"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: sma:SAV7039 sugar acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79790"
FT                   /db_xref="GOA:A1SDA5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDA5"
FT                   /protein_id="ABL79790.1"
FT                   /translation="MNPLARALGHGVLNRGVHAVWRWLDRAGEIVPGTHAAAAFGSFGA
FT                   GSCIDFPPATLLNCRSIHVGSGVLVGRQATLSVGYGADDPNIPDRALVIGDRSSLGARV
FT                   SITAHSSITIGESVFFGQSVFVTDASHGYQDPTRPIGEQFGAHQPVSIGSGSWIGHGAV
FT                   ILPGARIGRNAVVAAGAVVRGEVEDFAVVAGNPARVVRRLEPDVGWVDSRGDVRPVLEG
FT                   LFGSD"
     gtgaaccccc tcgcgcgcgc cctcggccac ggcgtcctca accgcggcgt ccacgcggtc        60
     tggcggtggc tggaccgagc cggcgagatc gtgcccggca cccacgccgc ggccgcgttc       120
     ggcagcttcg gcgccggcag ctgcatcgac ttcccaccgg ccacgctgct caactgccgc       180
     tcgatccacg tcggatccgg cgtgctcgtc ggccgccagg cgacgctctc ggtcgggtac       240
     ggcgcggacg atcccaacat tcccgaccgc gccctcgtga tcggggaccg atcgagcctc       300
     ggcgcccggg tgagcatcac cgcgcactcc tcgatcacga tcggcgagtc ggtgttcttc       360
     gggcagagcg tcttcgtgac cgacgccagc cacggctacc aggacccgac ccgcccgatc       420
     ggtgagcagt tcggcgcgca ccaaccggtc tcgatcggct cggggtcgtg gatcggccac       480
     ggcgcggtga tcctgcccgg cgcccggatc ggtcgcaacg ccgtggtcgc cgcgggcgca       540
     gtggtccgcg gcgaggtcga ggacttcgcg gtggtcgcgg gcaacccggc ccgcgtggtg       600
     cgccggctcg agcccgacgt cggctgggtc gactcccgcg gcgacgtacg ccccgtcctc       660
     gagggcctct tcggctcgga ctga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page