(data stored in ACNUC1104 zone)

EMBL: CP000509.PE246

CP000509.PE246       Location/Qualifiers
FT   CDS_pept        263534..266875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0251"
FT                   /product="DNA helicase/exodeoxyribonuclease V, gamma
FT                   subunit"
FT                   /EC_number="3.1.11.5"
FT                   /note="TIGRFAM: exodeoxyribonuclease V, gamma subunit;
FT                   PFAM: Exodeoxyribonuclease V, RecC subunit; KEGG:
FT                   mtc:MT0659 exodeoxyribonuclease V, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79796"
FT                   /db_xref="GOA:A1SDB1"
FT                   /db_xref="InterPro:IPR006697"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041500"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB1"
FT                   /protein_id="ABL79796.1"
FT                   /translation="MTLQIHRASRTDVLADALGDLLRTPLADPFAEEVVVVPAKGVERW
FT                   LTQRLSHRLGAGPRGDDGVCAGVRFLNPRSLVSLLLGRERDDPWDPERLVWPLLATIDE
FT                   SLGEREFATLGRHLGHGVDGADGELRRNRRYSVALRLAHLFASYALQRPSLVTAWREGR
FT                   DGEHGGEQGLPPDLAWQPELWRRLIAQVDAPPPDVRHAQTCAALQAGGDGLPLPDRLSL
FT                   FGHTRIPVTEVALLKALGEHRDVHLFLPQPSPVLWDDLADLGGPGGVVPRAADDSVERV
FT                   GHPLLASLGRDARELRRLLDGVSSEEVRPPAGTPTGSTTDPVTLLGWLQHDLRANHAPS
FT                   YDERSTRELDPDDHSLQVHACHGPARQVDVLREVLVGLLEDDPTLEPRDVLVMCPDIET
FT                   YAPLISAGFGLATTDGHPAHRLRVKLADRALTSTNPLLAVAGDLLDLAGGRVTASDVLD
FT                   LAGTDPVRRRFGFTDDELDRVSRWVARAGVRWGLDEESRAAFRMERFPHNTWRTGLDRI
FT                   LLGVAMSGDDHHHLGRGLPLDDVASSEIDLAGRLAELVARVDRTLTVLAGARTVADWAT
FT                   GLRDGVRSLVDVAADDAWQVPQFERELGRAAASSHEGGLELRLADVRAMLESRLAGRPT
FT                   RANFRTGSLTVATMVPMRSVPHRVVCLVGLDDGVFPRAGAVDGDDVLGRHPLTGERDVR
FT                   SEDRQLLLDAVLAATEHLVITYSGADEQSGASLPPAVPLGEILDAADRTTNAPVRDRVL
FT                   TRHPLQPYDARNFTRERPFSFDTAALAGARSARGVRREPPPLLDGPLPPRLALDGRAAD
FT                   VSLQDLRDFLGHPVRAFLRGRLDVATPFEPDDLADAIPVSLDSLEKWQIGDRLLRQLLA
FT                   GQDPVAVLTAEQLAGTLPPRGLGTLALHEVAEECQRLWSRTADLRDGERRSVDVDVDLR
FT                   DGRRLTGTVPGVYGSRVVSLGYSRLNARQRLHAWVDLLALSATYPDQHWTAHAVGKDRA
FT                   GPKRALCGPLDHRAVGWLRDLVDLRDRGLCAPLPVPVKTGAAWADAHARELMGQDHPPV
FT                   EAARREWETDPHNQFGITGEDADPYHQRVYGPAAPVEALLDAGLGEHAWAIWEPLLTGG
FT                   ERVGPL"
     gtgaccctgc agatccaccg agcctcgcgc accgacgtgc tcgcggacgc gctcggggac        60
     ctgctgcgca ccccgctggc cgacccgttc gccgaggagg tcgtggtcgt cccggccaag       120
     ggcgtggagc ggtggctgac ccagcggctc agccaccgcc tcggcgccgg accgcgcggt       180
     gacgacgggg tctgcgcggg ggtccggttc ctcaatccgc ggtcgctggt gtcgctcctg       240
     ctcgggcgcg agcgcgacga cccgtgggac cccgagcggc tcgtctggcc gctgctcgcg       300
     acgatcgacg agagcctcgg cgagcgtgag ttcgcgacgc tcgggcggca cctcggccac       360
     ggcgtggacg gcgccgacgg cgagctgcgc cgcaaccgcc gctactcggt ggcgttgcgg       420
     ctggcgcacc tgttcgcgtc gtacgcactg cagcggccgt cgctggtgac cgcctggcgg       480
     gagggccgcg acggcgagca cggtggcgag caggggctgc cgcccgacct ggcctggcag       540
     cccgagctgt ggcgccggct gatcgcccag gtcgacgcgc cccctcccga tgtccggcac       600
     gcccagacgt gcgcggctct gcaggcgggc ggcgacggcc tgccgctgcc cgaccggctc       660
     tcgctgttcg gccacacccg gatcccggtg accgaggtcg cgctgctgaa ggccctgggg       720
     gagcaccgcg acgtgcacct gttcctgccc cagccctcgc cggtgctctg ggacgacctg       780
     gccgacctcg gcggacccgg gggcgtcgtg ccccgggcgg ccgacgactc cgtcgagcgg       840
     gtcggacatc cgctgctcgc ctccctcggc cgcgacgcgc gcgagctccg gcggctgctc       900
     gacggcgtct cgtcggaaga ggtgcgccca cctgcgggga ccccgaccgg atcgaccacc       960
     gacccggtga ccctgctcgg ctggctccag cacgacctgc gcgccaacca cgccccgtcg      1020
     tacgacgagc gctcgacgcg cgagctcgac ccggacgacc acagcctgca ggtgcacgcc      1080
     tgccacggcc cggctcgtca ggtcgacgtg ctgcgcgagg tgctggtcgg cctgctcgag      1140
     gacgacccga ccctcgagcc gcgcgacgtc ctggtgatgt gccccgacat cgagacctac      1200
     gcgccgctga tctcggccgg gttcggtctc gcgaccaccg acgggcaccc cgcccaccgg      1260
     ctgcgggtga agctcgccga ccgcgcgctc accagcacca accccctgct cgccgtcgcc      1320
     ggggacctgc tcgacctggc cggcggccgg gtcaccgcgt ccgacgtgct cgacctggcg      1380
     ggcaccgacc cggttcgccg ccggttcggg ttcaccgacg acgagctgga ccgggtgtcg      1440
     cggtgggtgg cccgcgccgg cgtccggtgg ggcctcgacg aggagtcgcg cgcggcgttc      1500
     cggatggagc ggttccccca caacacctgg cgcaccggcc tcgaccggat cctgctgggc      1560
     gtcgccatga gcggcgacga ccaccaccac ctcggccggg ggctgccgct cgacgacgtc      1620
     gccagctccg agatcgacct cgcgggacgt ctcgccgagc tggtcgcgcg ggtcgaccgc      1680
     accttgaccg tgctcgccgg cgcgcggacg gtcgccgact gggccaccgg cctgcgcgac      1740
     ggcgtccggt cgctcgtcga cgtcgcggcc gacgacgcct ggcaggtccc gcagttcgag      1800
     cgcgagctcg ggcgcgccgc cgcgtcgtcg cacgagggtg ggctcgagct gcggctcgcc      1860
     gacgtgcgcg cgatgctcga gtcgcggctg gccgggcgcc cgacccgcgc caacttccgc      1920
     accggcagcc tgaccgtcgc caccatggtg ccgatgcgct cggtgccgca ccgcgtggtc      1980
     tgcctggtcg gcctcgacga cggggtcttc ccgcgcgcgg gtgcggtcga cggcgacgac      2040
     gtgctcgggc ggcatccgct caccggcgag cgcgacgtcc gcagcgagga ccggcagctg      2100
     ctcctggacg ctgtcctcgc cgcgaccgag cacctcgtca tcacctactc cggcgccgac      2160
     gagcagtccg gggcgagcct cccgcccgcc gtacccctcg gcgagatcct cgatgccgcc      2220
     gaccgcacca ccaacgcgcc ggtccgcgac cgggtcctga cccgccaccc gctccagccc      2280
     tacgacgcac gcaacttcac ccgcgagcgc ccgttcagct tcgacaccgc cgcgctggcc      2340
     ggcgcccggt cggcccgggg cgtacgccgc gagccgccgc cgctgctcga cgggccgctg      2400
     ccaccacggc ttgccctgga cgggagggcc gcggacgtgt cgctgcagga cctgcgcgac      2460
     ttcctgggtc acccggtccg ggccttcctg cgtgggcggc tggacgtggc gacgccgttc      2520
     gagcccgacg acctggccga tgcgatcccg gtgtcgctcg acagcctgga gaagtggcag      2580
     atcggtgacc ggctgctgcg gcagctgctc gccggccagg acccggtcgc cgtgctgacc      2640
     gccgagcagc tcgccggcac gctgccgccg cgcgggctcg gcaccctcgc gctccacgag      2700
     gtcgcggagg agtgccagcg gctgtggtcg cgcaccgccg acctgcgcga cggcgagcgc      2760
     cggtcggtcg acgtcgacgt cgacctgcgt gacgggcggc ggctcaccgg cacggtgccc      2820
     ggcgtctacg gaagccgggt ggtcagcctc ggctactccc ggctcaacgc gcggcagcgg      2880
     ctgcacgcgt gggtcgacct gctcgcgctg tcggcgacct accccgacca gcactggacg      2940
     gcccacgcgg tcgggaagga ccgcgcgggt ccgaagcgcg cgctgtgcgg accgctcgac      3000
     caccgcgccg tcggctggct gcgcgacctg gtcgacctcc gcgaccgcgg cctctgcgct      3060
     ccgctgccgg tgccggtgaa gaccggagcc gcgtgggcgg acgcccacgc gcgcgagctg      3120
     atgggccagg accacccgcc ggtcgaggcc gcgcgacggg agtgggagac cgacccccac      3180
     aaccagttcg gcatcaccgg cgaggacgcc gacccctacc accagcgcgt ctacggcccg      3240
     gctgcgcccg tcgaggccct gctcgacgcc ggtctcggtg agcacgcctg ggcgatctgg      3300
     gagccgctgc tgaccggcgg cgaaagggtc ggccccctgt ga                         3342
//

If you have problems or comments...

PBIL Back to PBIL home page