(data stored in ACNUC1104 zone)

EMBL: CP000509.PE247

CP000509.PE247       Location/Qualifiers
FT   CDS_pept        266872..270207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0252"
FT                   /product="exodeoxyribonuclease V, beta subunit"
FT                   /note="TIGRFAM: exodeoxyribonuclease V, beta subunit; PFAM:
FT                   UvrD/REP helicase; KEGG: mmc:Mmcs_0900 exodeoxyribonuclease
FT                   V, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79797"
FT                   /db_xref="GOA:A1SDB2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB2"
FT                   /protein_id="ABL79797.1"
FT                   /translation="MNAVRPFAITDPLPAGTVLLEASAGTGKTWTIGALLTRYVAEGVA
FT                   RLDQLLVVTFGRAASQELRERVRAQLVEAERVLGDDPVAGDSGDPGDPGDPGDSELVTL
FT                   LRSWGADERRRGHRRVTEALAGFDAATIATTHQFCSMVLDSLGVAGDTDSRARLVEDLD
FT                   DLVKETVDDLYLRAFADAEPAFTHDEAMAIARAAVGDPQARLEPAGADRSTIAGRKVSF
FT                   ADAVRTELDRRKRRLGILSYDDLLSQLADALAQPGSAAAQRMRARWRIVLVDEFQDTDP
FT                   VQWEVLDRAFSGHATMVLIGDPKQAIYAFRGGDVTTYLRAAETAQTRQTLAVNRRSDGP
FT                   LLAAVQTLLAGAELGDERIVVHDVTAHHGESRLAGAPVPHPFRLRVVRRDTFGRRGGST
FT                   LTVGQVRPHVARDLALDVRRLLASGATWCGEPIRPRDVAVISYRHADLATVREALLEVG
FT                   VPAVIAGGGSVFATPAAIEWLTLLEALEQPHRSTRVRSAALTCFFGHTAVELDARGDDL
FT                   TDEVADTLRGWVELFAGRGLAAVLEAANVAGLPERVLAEIGGDRRLTDLRHIGEALHEV
FT                   TLVARHGLPSLLTWLRGQVTEGRAGRGVERTRRLDSDAAAVQLVTIHASKGLEYPVVYV
FT                   PALADRFVPKPTRPLFHDDGGTRCLDVGGARSDDGWADHCRRWADEEAGEWLRLLYVAT
FT                   TRAKSQVVAWWAPTKNAVASPLHRMLMRDGDGPDGEMSASVPAAPAVPDDDAVVTLFSR
FT                   WRERGGPSPEAAIHADPGADPPRPATPDLAARTFTRTIDTEWRRASYSSLSRVEVAAPA
FT                   GAVVSEPEITGKEDEALAPEAVPVAPLLASDVPSPMAGLPVGATFGSLVHAVLEHTDPE
FT                   AVDLRAELLGHIDEQLGWWPVDLDREELADALVAVCDSPLGPLAAGTTLRQVTLGDRLR
FT                   EMEFELPLGDGLLGDLRPLLERHLPPGDPVRAYTAHLDGPLGEQTLRGYLTGSVDVVLR
FT                   LRSEAGPRYLVVDYKTNWLGPTDEPLTAHSYASVALDAAMGHSDYPLQALLYVAVLHRF
FT                   LRWRQPGYDPEQHLGGVLYLYLRGMCGPDTPSVDGAPCGVFAWRPPVALVEELSDLLDG
FT                   GARD"
     gtgaacgctg tgcgcccctt cgccatcacc gacccgctgc cggccggcac cgtgctgctc        60
     gaggcgagcg ccggcaccgg caagacctgg accatcggcg ccctcctcac gcggtacgtc       120
     gccgaaggag tcgcccggct cgaccagctg ctcgtcgtga cgttcggccg cgcggccagc       180
     caggaactgc gcgagcgggt gcgcgcgcag ctggtcgagg ccgagcgggt gctgggcgac       240
     gacccggtgg ccggcgactc cggtgacccc ggtgaccccg gtgaccccgg tgactccgaa       300
     ctcgtgacgc tgctgcgctc gtggggcgcc gacgagcggc gccgcggcca ccgccgggtc       360
     accgaggcgc tcgccggctt cgacgcggca accatcgcga ccacccacca gttctgctcg       420
     atggtgctcg actccctcgg cgtcgcaggc gacaccgact cccgggcgcg gctggtcgag       480
     gacctcgacg acctggtcaa ggagaccgtc gacgacctct acctccgcgc gttcgccgac       540
     gccgagccgg cgttcaccca cgacgaggcg atggccatcg cccgggcggc ggtcggcgac       600
     ccgcaggccc gcctcgaacc cgccggcgcg gaccgctcga cgatcgcggg ccgcaaggtg       660
     agcttcgccg acgccgtacg caccgagctc gaccgccgca agcgccggct cggcatcctc       720
     tcctacgacg acctgctctc ccagctcgcc gacgcgctcg cccagccggg gagcgccgcg       780
     gcccagcgga tgcgggcgcg ctggcggatc gtgctggtcg acgagttcca agacaccgac       840
     ccggtgcagt gggaggtcct cgaccgggcc ttcagcggcc acgccacgat ggtcctgatc       900
     ggcgatccga agcaggcgat ctacgcgttc cgcgggggcg acgtcaccac ctacctgcgg       960
     gccgccgaga ccgcgcagac ccggcagacg ctcgcggtca accgacgcag cgacggcccg      1020
     ctgctcgccg ccgtccagac gctcctcgcc ggcgcggagc tcggcgacga gcggatcgtc      1080
     gtgcacgacg tgaccgcgca ccacggcgag tcccgcctcg ccggtgctcc ggtcccgcat      1140
     ccgttccggc tgcgggtggt gcgccgcgac acgttcgggc gccgtggggg cagcacgctc      1200
     acggtcggtc aggtccgccc gcatgtcgcg agagacctgg cgctcgacgt acgccggctg      1260
     ctcgcgtcgg gcgcgacctg gtgcggggag ccgatccggc cgcgggacgt cgcggtgatc      1320
     agctaccgcc acgccgacct cgccaccgtc cgcgaggcgc tgctcgaggt cggggtgccg      1380
     gcggtgatcg ccggcggcgg cagcgtgttc gcgacccccg cggcgatcga gtggctcacg      1440
     ctgctggagg cgctcgagca gccgcaccgc agcacccgcg tgcgctcggc cgcgctgacc      1500
     tgcttcttcg ggcacaccgc cgtcgagctc gacgcccgcg gggacgacct gaccgacgag      1560
     gtcgccgaca cgctgcgcgg ctgggtcgag ctcttcgccg gccgcggcct cgccgcggtg      1620
     ctcgaggccg cgaacgtcgc gggcctgccg gagcgggtgc tcgcggagat cggcggggac      1680
     cggcggctga ccgacctgcg ccacatcggc gaggcgctgc acgaggtcac cctcgtcgcg      1740
     cggcacgggc tgccctcgct gctcacctgg ctgcgggggc aggtcaccga gggccgcgcg      1800
     ggccgcggcg tcgaacggac ccgccggctc gactccgacg cggccgccgt ccagctcgtc      1860
     accatccacg ccagcaaggg gttggagtac cccgtcgtct acgttcccgc cctcgccgac      1920
     cgcttcgtcc cgaagccgac ccgaccgctg ttccacgacg acggcggcac gcgctgcctc      1980
     gacgtcggcg gcgcgcgctc ggacgacggc tgggccgacc actgccggcg ctgggccgac      2040
     gaggaagcgg gcgagtggct gcggctgctc tacgtcgcga ccacccgggc caagtcgcag      2100
     gtggtcgcct ggtgggcgcc gaccaagaac gccgtcgcct cgccgctgca ccggatgctg      2160
     atgcgcgacg gcgacgggcc tgacggtgag atgtcggcga gcgtgcccgc cgcgccggcc      2220
     gtgccggacg acgacgccgt ggtcacgctg ttctcgcggt ggcgcgaacg tggcgggccg      2280
     agccccgaag ccgcgatcca cgccgacccg ggcgcggacc cgccacggcc ggcgaccccc      2340
     gacctcgcgg cgcggacgtt cacccgcacc atcgacaccg agtggcggcg cgcgtcgtac      2400
     tcctccctca gcagggtgga ggtggccgcg ccggccggcg cggtggtgag cgagccggag      2460
     atcaccggca aggaggacga agcgctcgct cccgaggccg tccccgtggc gccgctgctc      2520
     gccagcgacg tgccgtcgcc gatggcgggg ctgccggtgg gcgcgacctt cgggtcgctc      2580
     gtgcacgcgg tgctggagca caccgacccg gaggctgtcg acctgcgtgc cgagctgctc      2640
     ggccacatcg acgagcagct cggctggtgg ccggtcgatc tcgaccgtga ggagctggcc      2700
     gacgcgctgg tggcggtctg cgactccccg ctgggcccgc tcgccgccgg caccacgctg      2760
     cggcaggtca ctctcggcga ccggctgcgc gagatggagt tcgagctccc gctcggcgac      2820
     ggcctgctcg gcgacctccg cccgctgctg gagcggcacc tgccgcccgg tgacccggtc      2880
     cgcgcgtaca ccgcccatct cgacggcccg ctcggcgagc agaccctgcg cggctacctc      2940
     accggctccg tcgacgtcgt gctccggctg cgctcggagg cggggccgcg ctacctggtc      3000
     gtcgactaca agaccaactg gctcggaccc accgacgagc cgctcaccgc gcacagctac      3060
     gcgtcggtcg cgctcgacgc cgcgatgggc cactccgact accccctgca ggcgctgctg      3120
     tacgtcgccg tcctgcaccg gttcctccgc tggcgccagc ccgggtacga ccccgagcag      3180
     cacctcggcg gcgtcctcta cctctacctg cgcggcatgt gcgggccgga cacgccatcg      3240
     gtcgacggcg cgccctgcgg tgtgttcgcg tggcggccac cggtcgccct ggtcgaggag      3300
     ctctccgacc tgctggacgg cggtgcccgt gactga                                3336
//

If you have problems or comments...

PBIL Back to PBIL home page