(data stored in SCRATCH zone)

EMBL: CP000509.PE248

CP000509.PE248       Location/Qualifiers
FT   CDS_pept        270200..271954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0253"
FT                   /product="DNA helicase/exodeoxyribonuclease V, alpha
FT                   subunit"
FT                   /EC_number="3.1.11.5"
FT                   /note="KEGG: mpa:MAP4091c exodeoxyribonuclease V alpha
FT                   chain; TIGRFAM: exodeoxyribonuclease V, alpha subunit;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79798"
FT                   /db_xref="GOA:A1SDB3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB3"
FT                   /protein_id="ABL79798.1"
FT                   /translation="MTELFEPVDEHDWRIATGATGLLATFNAAGVLTSSDVHVATRIGV
FT                   LGGETDERMLLAVALTVRAVRRGSVCLDLAGVAATAPDLPWPDEWPVAGSPLVHAGVVR
FT                   WDHELLYLDRYHRLERQVHDDLAARLALAPPAVDEQRLEAALARLGGGHFSEEQRAAVV
FT                   AAVRRRTTILTGGPGTGKTTTVARLLALLADQAAGRGSRLSIALAAPTGKAATRLQEAV
FT                   VTELAAVATAWPEAPALVGRLDGLTLHRLLGWRPDNATRFRHDRANRLKYDVVVVDESS
FT                   MVELTMMGRLLEALRPDSRLVLVGDPQQLTSVGAGAVLSDLVAGYEGRPDSPVAALSTN
FT                   FRSEEDIKSLAAALRSGDADEVIAVLRAPSEQVSWVETSDAAEVEAALRPDSLASARAV
FT                   WAAARDEDAERALAELDRYRLLCAHREGLYGVRRWNHLVERWLAEDPDVEIYDEWYVGR
FT                   PLLVTSNDYALDVYNGESGVVVRQDQRRRVFVAGSERLKEFAPGRLEAVETMHAMTIHK
FT                   SQGSQADRVSVLLPDEGSRLLTLELFYTAITRARHHVRVVGSEAAVRAAVDTRAQRATG
FT                   LRARLADG"
     gtgactgagc tgttcgagcc cgtcgacgag cacgactggc ggatcgccac cggcgccacc        60
     gggctgctcg ccaccttcaa cgcggccggg gtgctgacct ccagcgacgt gcacgtcgcc       120
     acccggatcg gtgtcctcgg cggcgagacc gacgagcgga tgctgctggc ggtcgcgctg       180
     accgtgcggg ccgtccgccg cggctcggtc tgcctcgacc tcgccggcgt ggccgcgacc       240
     gccccggacc tgccctggcc cgacgagtgg ccggtggccg gctcgccgct cgtgcacgcc       300
     ggggtggtgc gctgggacca cgagctgctc tacctcgacc gctaccaccg gctcgagcgg       360
     caggtccacg acgacctggc cgcgcgcctc gcgctcgcac cgccggcggt cgacgagcag       420
     cggctcgaag cggcgctggc gaggctcggc ggcgggcact tcagcgagga gcagcgggcg       480
     gccgtggtcg cggccgtgcg ccggcgtacc accatcctga ccggcggccc cggcaccggg       540
     aagaccacga cggtggcgcg cctgctcgcg ctgctcgccg accaggccgc cggacgaggg       600
     agcaggctct cgatcgcgct ggcggcgccg accggcaagg ccgcgacccg gctgcaggag       660
     gccgtggtca ccgagctcgc ggcggtcgcg acggcctggc cggaggcgcc ggccctggtc       720
     ggacgactcg acgggctgac cctgcaccgg ctcctcggct ggcgcccgga caacgcgacc       780
     cggttccgcc acgatcgcgc caaccggctc aagtacgacg tggtcgtggt cgacgagtcc       840
     tcgatggtcg agctgacgat gatgggccgg ttgctggagg ccctgcgccc ggactcgcga       900
     ctggtgctgg tcggcgaccc gcagcagctc acctcggtcg gcgcgggtgc ggtgctgagt       960
     gacctggtgg ccggctacga gggccggccg gactcgccgg tcgcggcgtt gagcaccaac      1020
     ttccgctccg aggaggacat caagtccctg gcagcggcgc tgcgctccgg cgacgccgac      1080
     gaggtgatcg cggtgctgcg cgcgccgtcg gagcaggtct cctgggtcga gacctccgac      1140
     gcggccgagg tcgaggccgc gctgcgcccc gactcgctcg cgtccgcccg cgcggtctgg      1200
     gccgcggcgc gcgacgagga cgccgagcgc gcgctggccg agctggaccg ctaccggctc      1260
     ctgtgcgcgc accgcgaggg gctctacggc gtccgccgtt ggaaccacct cgtcgagcgc      1320
     tggctcgccg aggaccccga cgtggagatc tacgacgagt ggtacgtcgg ccgtccgctg      1380
     ctggtcacca gcaacgacta cgccctcgac gtctacaacg gggagagcgg ggtcgtcgtg      1440
     cggcaggacc agcggcggcg agtgttcgtg gcggggtcgg aacggctcaa ggagttcgcg      1500
     cccggccgtc tcgaggcggt cgagacgatg cacgcgatga cgatccacaa gagccagggc      1560
     agccaggccg accgggtgag cgtgctgctc cctgacgagg ggtcgcggct gctcaccctc      1620
     gagctgttct acacggcgat cacccgggcc cggcaccacg tgcgcgtggt cgggtcggag      1680
     gccgccgtgc gcgccgccgt cgacacccgg gcgcagcggg ccaccggtct gcgggcgcgt      1740
     ctcgcggacg gttga                                                       1755
//

If you have problems or comments...

PBIL Back to PBIL home page