(data stored in SCRATCH zone)

EMBL: CP000509.PE249

CP000509.PE249       Location/Qualifiers
FT   CDS_pept        272008..272631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0254"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   pac:PPA1121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79799"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB4"
FT                   /protein_id="ABL79799.1"
FT                   /translation="MPYLLRVELPDVPGSLGRLATAIGEAGGDIEAIEIVEKRHGGTAV
FT                   DDVFLEMDPGAMPDSVVSTVNALDGVRVLWVGRYAAGGNLFLDLEAVEELTEDPEHALG
FT                   RLIDRLPVVFRADWAARVSKADGVVYATGAAPKELAWQPIERAETIGSADENNIHCAAR
FT                   LNKSEIVVIGRRGGPAFLDSEIARLGHLTGLAMSIARAARAATP"
     atgccctacc tgctgcgcgt ggagctgccc gacgtcccgg gatcgttggg tcggctcgcc        60
     acggccatcg gtgaggccgg tggcgacatc gaggcgatcg agatcgtcga gaagcggcac       120
     ggcggcacgg ccgtcgacga cgtgttcctc gagatggatc cgggcgcgat gccggactcc       180
     gtggtctcga ccgtcaacgc cctcgacggc gtccgggtgc tgtgggtcgg gcggtatgcc       240
     gcgggcggca acctgttcct cgacctcgag gccgtcgagg agctgacgga ggaccccgag       300
     cacgccctcg ggcggctgat cgaccggctc ccggtggtgt tccgcgccga ctgggccgca       360
     cgggtcagca aggccgacgg cgtcgtctac gccacgggcg ccgcgccgaa ggagctcgcc       420
     tggcagccga tcgagcgcgc ggagacgatc ggctccgcgg acgagaacaa catccactgc       480
     gccgcccggc tgaacaagtc cgagatcgtc gtcatcggcc gacgcggcgg cccggccttc       540
     ctcgactccg agatcgcccg cctcggccac ctgaccggcc tcgccatgtc gatcgcccgc       600
     gccgcccgcg cggccacccc ctga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page